SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014144 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014144
Domain Number 1 Region: 416-458
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000252
Family LIM domain 0.00029
Further Details:      
 
Domain Number 2 Region: 382-415
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000755
Family LIM domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014144   Gene: ENSMPUG00000014253   Transcript: ENSMPUT00000014370
Sequence length 761
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897186.1:16265:73161:1 gene:ENSMPUG00000014253 transcript:ENSMPUT00000014370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESAPFNRRQWTSVSLRVTAKELSLVNKNKSSAIVEIFSKYQKAAEEANMEKRRSNTENL
PQHCRRGILTVLKKKWENPAQGTESHTDALRDGSAEVRHGGSGPAGDLSRSSASEAEADQ
EGRAHPRPRLGSPPEALTQCLYPRTEASERLKDHSKESKKMENCLGESRHEVGKPEINEN
TEASNKIEKYNVPLNRLKMMFEKGEPAPTKVLRSQSRGAGGRKISENSFSLDDLELGPGQ
LSSSTFNTEKSESRRNLDLPRLSETSIKDRMAKYQAAVSKQTGSTSSTNDLRANGGEIRT
HKLEQKENVPPDPEVCISHQVGEKVSATENSLAVRSTPAEDDSCNSQFKSEVQQPVHPKP
LNPDARASSLSENSPPKAVKKFQTPARETCVECQKTVYPMERLLANQQVFHVSCFRCSYC
NNKLSNSLGTYASLHGRIYCKPHFNQLFKAKGNYDEGFGHRPHKDLWASKNENEGVLERP
AQLPNAGETPQSPGVEDAPIAKVGVLTATMEAKASSQPEKEDKPAETKKLKIAWPPPTEL
GSSGSILEEGIKVSKPKWPPEDEISKPDAPEDVDLDLKKLRRSSSLKERSRPFTVAASFR
TTSVKSPKILSPPIRKGWSMSEQSEELIGGATAERKQVENAHTSEKNGSVGKTTWQNQES
RGGEMGGRSKEDHSFEMGSENLTENGANLDEDEGGLKQQSPLEPKSTNWSSFADDTSPKE
FTTPSQKSQDVGFWEEEVVQELSVEEQIKRNRYYDEDEDKD
Download sequence
Identical sequences M3YS34
ENSMPUP00000014144 ENSMPUP00000014144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]