SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014161 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014161
Domain Number 1 Region: 5-326,439-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.45e-48
Family FAD-linked reductases, N-terminal domain 0.00062
Further Details:      
 
Domain Number 2 Region: 312-421
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.16e-22
Family L-aminoacid/polyamine oxidase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014161   Gene: ENSMPUG00000014269   Transcript: ENSMPUT00000014387
Sequence length 477
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897121.1:2636239:2640027:1 gene:ENSMPUG00000014269 transcript:ENSMPUT00000014387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVEGSERLGGWIRSVRGPGDAVFELGPRG
IRPAGAVGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPSGLRGLFRPSP
PFSKPLFWAGLKELTTPRGKDPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSVLLGLLLGAGRSPQPDSALIRQARAERWSQWSLRGGLETLPQAL
YTHLTSRGVTVLKGQPVCGLSLQAEGRWKVSLGDGSLEADHVISAVPASVLSGLLPAQAA
PLACALRAITAVSVAVVNLQYRGARLPVQGFGHLVPSSEDPGVLGIVYDSIAFPEQDGSP
PGLRVTVMLGGSWLQTLEARGSVLSQELFQQQAQQAAAAQLGLREPPSHCLVHLHKNCIP
QYTLGHWQKLEAATQFLASQRLPLTLAGASYEGVAVNDCIESGRQAAARALGSEPNS
Download sequence
Identical sequences M3YS51
ENSMPUP00000014161 XP_004775971.1.14098 ENSMPUP00000014161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]