SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014164 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014164
Domain Number 1 Region: 100-165,213-350
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-24
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 410-542
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-21
Family Pleckstrin-homology domain (PH domain) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014164   Gene: ENSMPUG00000014272   Transcript: ENSMPUT00000014390
Sequence length 803
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:29021471:29053912:-1 gene:ENSMPUG00000014272 transcript:ENSMPUT00000014390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPQAKAVGGLRESGRRSGTSWLTEQGSPSGVLEQLLPELTGLLSLLDHEYLSDTALEKK
MAVASILQSLQPLPAKEVSYLYVNTADLHSGPSFVESLFEEFDCDLSDLRDMPEDDGEPC
KGASPEPAKSPSLRHSADLPPPLPQRPPPEDYYEEALPLGPGKSPEYISSHSAAPSTNPT
DGCSPAHSIMDGYYEDADSSYPATRMNGELKNSYNDSDPMSSSYESYDEEEEEGKGPQPT
HQWPSEEASMHLVRDCRICAFLLRKKRFGQWAKQLTVIKEDQLLCYKSSKDRQPHLRLAL
DVCSVTYVPKDSRHKRHELRFSQGATEVLVLALQSREQAEEWLKVIREVSRPAGATEGTD
VPRSPVLLCKLDLDKRLSQEKQTSDSDSLGMGDNCSTLGRREACDQGKAKKSSLAELKGS
VSRAAGRKITRIISFSKKKPLADDPQMPCSEEEVPCCGYLNVLVNQGWKERWCRLKCNTL
YFHKDHTDLRTHVNAIALRGCEVAPGFGPRHPFAFRILRNRQEVAILEANCSEDMGRWLG
LLLVEMGSKVTPEALHYDYVDVETLTSIVSAGRNSFLYARSCQDQWPEPRVYDDVPYEKI
QDEEPKRPAGTQVKRHASSCSEKSHRVDPQVKVKRHASSANQYKYGKNRAEEDARRYLVE
KEKLEKEKETIRTELMALRQEKRELKEAIRNNPGTKLKALEEAVAALEAQCRAKEERRID
LELRLVAVKERLQQSLAGGPTLGLSVSSKNKSGETANKPQNNAPEQPLPVNCVSELRKRS
PSIVTSNQGRVLQKAKEWEMKKT
Download sequence
Identical sequences M3YS54
ENSMPUP00000014164 ENSMPUP00000014164 XP_004737928.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]