SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014173 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014173
Domain Number 1 Region: 106-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.44e-16
Family LIM domain 0.0019
Further Details:      
 
Domain Number 2 Region: 177-239
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.48e-16
Family LIM domain 0.0019
Further Details:      
 
Domain Number 3 Region: 49-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000437
Family LIM domain 0.0023
Further Details:      
 
Domain Number 4 Region: 236-269
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000855
Family LIM domain 0.0021
Further Details:      
 
Domain Number 5 Region: 144-176
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000558
Family LIM domain 0.0011
Further Details:      
 
Domain Number 6 Region: 19-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000689
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014173   Gene: ENSMPUG00000014280   Transcript: ENSMPUT00000014399
Sequence length 674
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:29096779:29198853:-1 gene:ENSMPUG00000014280 transcript:ENSMPUT00000014399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSIPYQQNPYNPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSG
FFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDK
VTFSGKECVCQTCSQSMTSSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQT
CGVILTGEYISKDGVPYCESDYHSQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCH
QMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSISPPGSSIGSPNRVICAKVD
NEILNYKDLAALPKVKSIYEVQRPDLISYEPHSRYTSDEMLERCGYGESLGTLSPYSQDI
YENLDLRQRRASSPGYIDSPTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSS
TPTSYQAPKHFHIPAGESNIYRKPPIYKRHGDLSIATKSKTSEDVSQASKYSPAYSPDPY
YAAESEYWTYHGSPKAARARRFSSGGEEEDFDRSMHKLQSGIGRLILKEEMKARSSSYAD
PWTPPRSSTSSREALHTAGYEMSLNGSPRSHYLADSDPLISKSASLPAYRRNGLHRTPSA
DLFHYDSMNAVNWGMREYKVKETQRHWGSHHRCCYTGTQQEDVSTIYSGKGYQINNLKVS
LQASISSPSLASFP
Download sequence
Identical sequences M3YS63
ENSMPUP00000014173 ENSMPUP00000014173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]