SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014179 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014179
Domain Number 1 Region: 311-392
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014179   Gene: ENSMPUG00000014286   Transcript: ENSMPUT00000014405
Sequence length 394
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:8970703:8980108:1 gene:ENSMPUG00000014286 transcript:ENSMPUT00000014405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLCAGCRAAPSRRGAGPLQVAGCGSKGADMDFDSYQHYFYDYDCGEDFYRSTAPSEDIW
KKFELVPSPPTSPPWGSGPGAGDSAPGIGPPEPWPGGGAGEEAESRGHSKAWGRNYASII
RRDCMWSGFSARERLERAVSDRLAAGAPRGNPPKAPAAPDCAPSLEAGNPAPAAPGPLGE
PKTQACSGSESPSDSEGEEIDVVTVEKRQSLGVRKPVTITVRADPLDPCMKHFHISIHQQ
QHNYAARFPPESCSQGGAPERGPQEEALERDVPEEKEEEADEEIVSPPPVESEAPQSCHP
KPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYL
QALVGAEKRMATEKRQLRCRQQQLQKRIAYLSGY
Download sequence
Identical sequences M3YS69
XP_004740752.1.14098 ENSMPUP00000014179 ENSMPUP00000014179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]