SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014244 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000014244
Domain Number - Region: 55-132
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0209
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014244   Gene: ENSMPUG00000014353   Transcript: ENSMPUT00000014472
Sequence length 157
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:4611525:4615229:1 gene:ENSMPUG00000014353 transcript:ENSMPUT00000014472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHLPAATSAPSEQSFSREAGRETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKE
ECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQA
LIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK
Download sequence
Identical sequences M3YSD4
XP_004747080.1.14098 XP_004747081.1.14098 XP_012909010.1.14098 ENSMPUP00000014244 ENSMPUP00000014244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]