SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014272 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014272
Domain Number 1 Region: 170-239
Classification Level Classification E-value
Superfamily Homeodomain-like 6.42e-18
Family Homeodomain 0.0000519
Further Details:      
 
Domain Number 2 Region: 44-110
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000376
Family LIM domain 0.027
Further Details:      
 
Domain Number 3 Region: 14-42
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000112
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014272
Domain Number - Region: 107-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00104
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014272   Gene: ENSMPUG00000014380   Transcript: ENSMPUT00000014500
Sequence length 349
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:33055422:33065116:-1 gene:ENSMPUG00000014380 transcript:ENSMPUT00000014500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFV
RDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEK
TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS
IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
SDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
Download sequence
Identical sequences A0A061ILJ5 A0A091D1I7 A0A096N282 A0A0D9RVX7 A0A1S2ZGD2 A0A1S3FDG9 A0A1U7QNL2 A0A2J8V5Y7 A0A2K5C137 A0A2K5KAB7 A0A2K5MRF3 A0A2K5VBK8 A0A2K5XS53 A0A2K6DK81 A0A2K6FFX0 A0A2K6K779 A0A2K6P0S2 A0A2K6U2X1 A2RSV5 A6H796 F1SMF7 G1RIK5 G1TSL8 G3TJI2 G5C265 G7MTP9 H0V6A5 H2QQV3 I3MKS5 M3WF59 M3YSG2 P61371 P61372 P61373 P61374 U3BK73
gi|115387114|ref|NP_002193.2| ENSTTRP00000010273 ENSRNOP00000017305 ENSNLEP00000013061 ENSMPUP00000014272 ENSBTAP00000001638 ENSRNOP00000017305 ENSMUSP00000044879 ENSPANP00000006425 ENSCHOP00000011070 ENSNLEP00000013061 ENSMUSP00000044879 ENSPTRP00000028882 ENSLAFP00000014889 ENSETEP00000010703 ENSMUSP00000044879 ENSMPUP00000014272 ENSCPOP00000005215 ENSTTRP00000010273 ENSSTOP00000011938 ENSCHOP00000011070 ENSP00000230658 ENSPTRP00000028882 ENSETEP00000010703 ENSSTOP00000011938 ENSP00000230658 ENSCPOP00000005215 ENSOCUP00000020036 NP_001092600.1.59421 NP_001092600.1.76553 NP_002193.2.87134 NP_002193.2.92137 NP_059035.3.100692 NP_059035.3.4139 NP_067434.3.92730 XP_001150633.2.37143 XP_002714072.1.1745 XP_003133982.1.46622 XP_003276562.1.23891 XP_003408074.1.64505 XP_003470238.1.53824 XP_003498440.1.69978 XP_003782831.1.62490 XP_003827396.1.60992 XP_003925922.1.74449 XP_003981473.1.62641 XP_004265987.1.21590 XP_004328963.1.83887 XP_004380509.1.4749 XP_004411019.1.74151 XP_004422855.1.5094 XP_004583747.1.84141 XP_004608479.1.94378 XP_004678389.1.23501 XP_004703681.1.18182 XP_004737963.1.14098 XP_004848599.1.39548 XP_005082833.1.91757 XP_005319705.1.77405 XP_005556929.1.63531 XP_005893336.1.15283 XP_005971018.1.78601 XP_006047638.1.26621 XP_006731726.1.47382 XP_006865807.1.41390 XP_006901228.1.29581 XP_006912510.1.64745 XP_007076713.1.5354 XP_007110576.1.24612 XP_007195632.1.59432 XP_007470802.1.90284 XP_007518966.1.11023 XP_007626438.1.28591 XP_007948747.1.48129 XP_007970298.1.81039 XP_008519717.1.77740 XP_008573656.1.73410 XP_008690779.1.72690 XP_008831159.1.79516 XP_010362709.1.97406 XP_010642316.1.5607 XP_011372190.1.92234 XP_011770198.1.29376 XP_011794730.1.43180 XP_011829103.1.47321 XP_011885467.1.92194 XP_012000479.1.54773 XP_012304980.1.9421 XP_012510731.1.63892 XP_012595874.1.48125 XP_012874017.1.60039 XP_014710438.1.49734 XP_014941455.1.86478 XP_014995553.1.72884 XP_015352867.1.40921 XP_015997755.1.101085 XP_016054180.1.3490 XP_017747299.1.44346 XP_017921261.1.57651 XP_019319866.1.44245 XP_019496959.1.44202 XP_019591764.1.88060 XP_020009098.1.5219 XP_020733947.1.74333 XP_021518106.1.76796 XP_021552464.1.83697 XP_853721.2.84170 HGL_H00000230658 10090.ENSMUSP00000044879 10116.ENSRNOP00000017305 10141.ENSCPOP00000005215 9598.ENSPTRP00000028882 9606.ENSP00000230658 ENSLAFP00000014889 ENSBTAP00000001638 ENSP00000230658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]