SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014274 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014274
Domain Number 1 Region: 678-788,822-864
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.38e-29
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0062
Further Details:      
 
Domain Number 2 Region: 6-16
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000141
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014274   Gene: ENSMPUG00000014382   Transcript: ENSMPUT00000014502
Sequence length 893
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:33520495:33698171:-1 gene:ENSMPUG00000014382 transcript:ENSMPUT00000014502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSRPPPPPPPPPPPPLSPRITSETTSPPAPASARGIYLMGMCSRQERIQKDIDVVIQKS
RAEKDCLFADFRYSDSTFTFTYVGGPKSVSYSVHVSEDYPDNTYVSSSENDEDVLVTTEP
IPIIFHRIATELRKTNDTNCCLSIKSKLQKENGEESRQNSTVEEDSEGDNDSEEFYYGGQ
VNYDGELHKHPQLEADLSAVREIYGPHAVSLREYGAIDDVDIDLHIDVSFLDEEIAVAWE
VIRTEPIIVRLHCSLTQYLNGPVPTVDVFQISTKERFGLGHQLKKIMQTFVTQQWKQSKD
KSNCLHNKKLSEKKVKSPLHLFSTLRRSPSYPPPGCGKSKSKLKSEQDGISKTHKLLRRT
CSSAVKTDDVCATKSHRTFGRSLSSDPRAEQTVPAIKSHKLLNRPCPAAVKQEDCLTLKS
HKLLTRSCSGDPRCEHNTGLKPHKLLSRSYSSNLRMEELYGLKSHKLLSKSYSGAPKSSK
TELFKEPNAEGRRLSLTSGLIGILTPSSSSSSQPAPNGAKCIPIRDRGFLVQTIEFAEQR
IPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQTLGVMNEAADEIATGAQVVDLL
VSMCRSALESPRKVVIFEPYPSVVDPNDPQMLAFNPRKKNYDRVMKALDSITSIREMTQA
PYLEIKKQMDKQDPLAHPLLQWVISSNRSHIVKLPVNRQLKFMHTPHQFLLLSSPPAKES
NFRAAKKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISF
GYSGMNKKQKVTTKDEPASSSKSSSASQSQKKGQQSQFLQSRNLKCIALCEVITSPDLHK
HGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIHKEILRVIGNQTATG
Download sequence
Identical sequences M3YSG4
ENSMPUP00000014274 XP_004737965.1.14098 ENSMPUP00000014274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]