SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014280 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014280
Domain Number 1 Region: 126-429
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.05e-68
Family Nuclear receptor ligand-binding domain 0.00000000977
Further Details:      
 
Domain Number 2 Region: 27-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-26
Family Nuclear receptor 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014280   Gene: ENSMPUG00000014388   Transcript: ENSMPUT00000014508
Sequence length 430
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897121.1:2690814:2694982:-1 gene:ENSMPUG00000014388 transcript:ENSMPUT00000014508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ANPSHIQGPATAIETSEAMASGEDGPRSCVVCGDRATGYHFHALTCEGCKGFFRRTVNKS
TGLTCPFAGRCEVSKAQRRHCPACRLQKCLDVGMKKESTVILSAEALAARRAKQAQRRAQ
QVPAQLSKEQEELVRTLLGAHSRHVGTMFNQFVQFRVSLCMDFELKEDQKGTRGGCPEGG
GSSVPRPKTEDEASPEPQRPQAPRPRSPSKTGLERPLGPPAHLFIHHQRLPVPVPELPLL
THFAEVNTFMVQQVIKFTKDVPLFRSLPMEDQISLLKGAAVEICHIALNTTFCLQTQNFL
CGPLCYTLEDGVHAGFQQDFLELLFRFHGTLRRLQLQEPEYVLMAAMALFSPDRPGVTQR
AEIDHLQEVVAMTLQSYIKGQPPRPGDRFLYAKLLGLLAELRSINNAYGYQIQHIQGLSA
MMPLLQEICS
Download sequence
Identical sequences M3YSH0
ENSMPUP00000014280 ENSMPUP00000014280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]