SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014305 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014305
Domain Number 1 Region: 43-99
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 107-159
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000288
Family Hairy Orange domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014305   Gene: ENSMPUG00000014412   Transcript: ENSMPUT00000014533
Sequence length 328
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:9203046:9219550:1 gene:ENSMPUG00000014412 transcript:ENSMPUT00000014533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPREPSGSDSESDGPIDVGREGELSQMARPLSTPSPSQMQARKKRRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPAGPLAFPAWPWSFF
HSCPGLSAPSNQLTILGRVPGPILPSAPSLAYPLQALRTAPVRRATGTILPARRNLLPSR
GASSMRRARPLERPAAPLPVAPSIRAARSSHTTPLLRSSSPVSPGIVGSPAYVALPAPRP
SSPGASGRPAGAGPCHSWVSEITEIGAF
Download sequence
Identical sequences M3YSJ5
ENSMPUP00000014305 XP_004740757.1.14098 ENSMPUP00000014305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]