SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014321 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014321
Domain Number 1 Region: 666-742
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000491
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014321   Gene: ENSMPUG00000014428   Transcript: ENSMPUT00000014549
Sequence length 761
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:1897734:1907438:1 gene:ENSMPUG00000014428 transcript:ENSMPUT00000014549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSEASGRRDTQALLPVTQTMELRNRDYHVERPLMNQQQLEELGHRTSATRTYQWRTWF
QCSRARARALLFQYLPVLSWLPRYPLRDWLLGDLLAGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFVYFLFGTSRHISVGTFAVMSVMVGSVTESLAPDENFLQGVNATVDEVTR
DHVRVQLASTLSVLVGLFQVGLGLVRFGFVVTYLSEPLVRGYTTAASVQVFVSQLKYVFG
LQLSSRSGPLSLIYTVLEVCSLLPRSVVGTVVTALVSGVVLVLLKLLSDKLHRYLPMPIP
GELLTLIGATGISYGVGLKSRFGVDVVGDIPAGLVPPVAPSPKLFASLVGYAFTIAVVGF
AIAISLGKIFALRHGYRVDSNQELVALGLSNFIGGIFQCFPVSCSMSRSLVQEGSGGNTQ
VAGAVSSLFILIIIVKLGELFRDLPKAVLAAAIIVNLKGMLKQFTDIPSLWKSNQMDLLI
WLVTFVATILLNLDIGLAIAIVFSLLLVVFRTQMPPPGAAASLPPPQGRRSGQSFVFFPA
PMPVTAWTTSSILGCSWNWSKPHRPQTGGPGSQALVPGLPSCPKPGGDTRLGWLGCPVTA
GTATASSEGTSVSVQVNTNITDVESNNVDDSMARASTGNELEDTTVSGQEDAKAANGSTL
KALGLPQPHFHSLVLDLGALSFVDTVCIKSLKNIFRDFREIEVEVYMAACHAPVVSQLEA
GHFFDASITKQHLFASVHDAVLFALQHPRSSPASPVSVSRP
Download sequence
Identical sequences M3YSL1
ENSMPUP00000014321 ENSMPUP00000014321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]