SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014323 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014323
Domain Number 1 Region: 93-325
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.06e-86
Family Calponin-homology domain, CH-domain 0.000000993
Further Details:      
 
Domain Number 2 Region: 1542-1766
Classification Level Classification E-value
Superfamily Plakin repeat 1.44e-53
Family Plakin repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 1770-1948
Classification Level Classification E-value
Superfamily Plakin repeat 7.19e-49
Family Plakin repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 2398-2590
Classification Level Classification E-value
Superfamily Plakin repeat 6.02e-41
Family Plakin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 6300-6458
Classification Level Classification E-value
Superfamily Spectrin repeat 3.22e-31
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 5311-5471
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-28
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 7 Region: 6737-6887
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-27
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 8 Region: 2690-2803
Classification Level Classification E-value
Superfamily Plakin repeat 2.22e-25
Family Plakin repeat 0.0011
Further Details:      
 
Domain Number 9 Region: 341-457
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-24
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 10 Region: 5422-5569
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-23
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 11 Region: 4876-5033
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 6847-6973
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-22
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 13 Region: 6540-6678
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 14 Region: 5871-6015
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-21
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 15 Region: 7250-7332
Classification Level Classification E-value
Superfamily GAS2 domain-like 8.5e-21
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 16 Region: 6956-7083,7110-7141
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-20
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 17 Region: 6099-6240
Classification Level Classification E-value
Superfamily Spectrin repeat 6.6e-20
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 18 Region: 3987-4124
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-19
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 19 Region: 5749-5906
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-17
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 20 Region: 5531-5675
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-16
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 21 Region: 2581-2686
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-16
Family Plakin repeat 0.0034
Further Details:      
 
Domain Number 22 Region: 5090-5250
Classification Level Classification E-value
Superfamily Spectrin repeat 4.2e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 23 Region: 6456-6572
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-16
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 24 Region: 7161-7241
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000124
Family Polcalcin 0.057
Further Details:      
 
Domain Number 25 Region: 1258-1384,1411-1437
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000303
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 26 Region: 4767-4887
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000033
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 27 Region: 4098-4237
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000662
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 28 Region: 4589-4707
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000792
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 29 Region: 4476-4596
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000877
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 30 Region: 3854-3976
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000088
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 31 Region: 4190-4340
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000734
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 32 Region: 704-819
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000204
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 33 Region: 4314-4416
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000628
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 34 Region: 6020-6126
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000105
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 35 Region: 622-712
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000157
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 36 Region: 3640-3757
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000209
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 37 Region: 2303-2396
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000131
Family Plakin repeat 0.0018
Further Details:      
 
Domain Number 38 Region: 3472-3626
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000619
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 39 Region: 1455-1571
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000117
Family Spectrin repeat 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014323
Domain Number - Region: 5225-5303
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0108
Family Spectrin repeat 0.024
Further Details:      
 
Domain Number - Region: 820-894
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0134
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014323   Gene: ENSMPUG00000014430   Transcript: ENSMPUT00000014551
Sequence length 7561
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:9327852:9667570:-1 gene:ENSMPUG00000014430 transcript:ENSMPUT00000014551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPPSDPSYQKPSGPPVPGLPGPPTAAPAWAMSSSDEETLSERSCRSERSCRSERSYRSE
RSGSLSPCPPGDTLPWNLPLHEQKKRKSQDSVLDPAERAVVRVADERDRVQKKTFTKWVN
KHLMKVRKHINDLYEDLRDGHNLISLLEVLSGIKLPREKGRMRFHRLQNVQIALDFLKQR
QVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISDIYISGESGDMSAKEKLLLWTQKVTA
GYTGIKCTNFSSCWSDGKMFNALIHRYRPDLVDMERVQIQSNRENLEQAFEVAERLGVTR
LLDAEDVDVPSPDEKSVITYVSSIYDAFPKVPEGGEGISATEVDSRWQEYQSRVDSLIPW
IKQHTILMSDKSFPQNPVELKALYNQYIHFKETEILAKEREKGRIEELYKLLEVWIEFGR
IKLPQGYHPNDVEEEWGKLIIEMLEREKSLRPAVERLELLLQIANKIQNGALNCEEKLTL
AKNTLQADAAHLESGQPVQCESDVIMYIQECEGLIRQLQVDLQILRDENYYQLEELAFRV
MRLQDELVTLRLECTNLYRKGHFTSLELAPPSALTTTHLKAEPLTKGTHSSSTSWFRKPM
TRAELVSISSSEDEGNLRFVYELLSWVEEMQMKLERAEWGNDLPSVELQLETQQHIHTSV
EELGSSVKEARLYEGKMSQNFHTSYVETLGKLETQYCKLKETSSFRMRHLQSLHKFVSRA
TAELIWLNEKEEEELAYDWSDNNPNISAKRNYFSELTMQLEEKQDVFRSLQDTAELLSLE
NHPAKQTVEAYSAATQSQLQWMKQLCLCVEQHVKENTAYFQFFSDARDLESFLRNLQDSI
KRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQSKSSVASLVGRSKTIVQLKPRSPDHVLKS
TISVKAICDYRQIEITICKNDECVLEDNSQRTKWKVISPTGNEAMVPSVCFLIPSPNKDA
IEMATRVEQSYQKVMALWHQLHVNTKSLISWNYLRKDLDLVKTWNLEKLRSSAPGECHQV
MKTLQAHYEDFLQDSRDSLVFSVSDRLRLEEEVEACKTHFQHLMKSIENEDKEETVAKMY
ISELKNIRLRLEECEQRLVKRIQSPASSRTDKDARQDNALRIAEQERTQEDLQQLRSEFD
VVSTKCNSFLHQSPSGSSVPSLRSELNLLVEKIDHVYGLSTVYLNKLKTIDVIVRSIQDA
ELLVKGYEIKLSQEEAVPADLSALESHRSTLRHWLSDVKDKNSVFSVLDEEIAKAKVVAE
QLSRLTPERNLDLERYQEKGSQLQDRWHRVIVQLETRQSELESIQEVLGDYRACHGTLIR
WIEETTAQQEMMKPGQAEDSRVLSEQLSQQTDLFAEIEKNQSKLDQCQKFSQQYSTIVKD
YELQLMTYKAFVESQQKSSGKRRRMLSSSDAITQEFMDLRTRYTALVTLTTQHVKYISDA
LRRLEEEEKVVEEEKQEHVEKVKELLGWVSTLARNTQSKATSSQTKESTDIEKAILDQQV
LAEELTTRRDQVSEAIKTSQIFLAKHGHKLSEKEKEQISEQLNALNKAYHDICDGSANQL
QQLQSQLAQQTEQKGCRAVAGVIDLGTVEIFPIFRAMQKGLIDQDTGLVLLESQVIMSGL
IAPETSEKLSLEGGLARNLINPQMYQQFQELQDALSLISGLRESKGLLSVVEAIDKKIIN
EKVGLKVLEAHLATGGFSLPPNEGCINLEEAFHQGLISPRLHSVLESYLKSSKNLIDPNT
AEKISLLDLMQRCIVHQDSGLKLLPVKQLAGGMVSLKSGRKVSIFRAVQEGLIDRQVTVR
LLEAQLFAGGIVDPRTGHRLTVEEAVRHNLIDQDMACALLIRQLQTGGIIDTITGHRLTI
DEAVNNDLVAAKIALVILESLWSFMGLLWPESGEILPITDALEQGIVSTELAHKILSGRQ
HIKALFLPASTEVWSWKRAVEDGMLDKDLVSNLKSICIPDVMPHMQLAESSERSKWNIHP
GAVGLPQSQSQTESIVSPSEKLLFQLMTHSYINVQDGQRLLLLDNELMETLTARGEYQAN
PPEVFEVGHQRLETPKELQELANVKTTETFCDGLNVRPCEFQVPFQNEEYSNQGDCTEAK
GKMTTVEIEASTMENPKRDLFVGEQKVRDPNVDTLMVLDKGKSELKGQLLGTKKEELIGM
ATRENVSRGFLLTAPTEEAEDVTLVVSKDPFPVETLKEEGQTPRKTSFLCQTEQADTLEI
EIPGETGRPVIKPQSRKSQFQVKKTLDLESELKSENDMAILDKKKSLNKTFLDRDDHKQN
PEGHNIVGSSVVTLDKTDVEDSGHETSLSCSHPSELLQEATLNKLSAQLLDGGIIHNQTG
QKLLLNEAIARGIVPSHTAVKLMGKLNMFRGFFDSQTCESLTTAEVIDEGLMDEKLLHNV
LMADKAISGVLDPRTHTLCSVKEAVAAGLLDTQTASRILEGQVVTGGIVDLKRGKKVSVT
LASNLGLVDSADQTELINLEKASKGRDAEKTVRETFISLQMETTGIMDPDNKAPLTIMQS
IDRGLLEREEAIRLLTKQVVDGGIIHHISGMRVSVDNAFEHGIIDEDLAKQLKKVEKLSL
CRFFHPETKETISLPEAIKLDLVTPDLKREIHEIQTLTGSFVDLISVQRLTLAEAEKEGL
LTNKAILSSGMMHGIVDPENYRIVPYSELVKKCKIDIESGQRYLEVIPFSDIKDEASNRV
LTLSQATQLGKVDFISTLKVLEAQANTGGIIDTATGKRLTLASALEQKIVDENMARIIAS
HQVLNGGIVDIFNDQRVTLKEAVEKGFISPELATMIQIDTSESCSHGAQVEKQDGVEVCV
IEKEFLRREMLVACNQTAGMSYSKGAGEKLLEIRSQSAQGKVKTTRVSSRGQAKKSREIS
LKELECKDQDKRSTSPEAEKSVSIIIPGDDKDTLLGQGSVTVSHLEVHDFNLKEAASDDM
EKNTNEMQENIEAKMEITYYMKTSLSGQDPKEIRESQGRIISGGRESDYETSGKLLSEQI
MQKPMNTKEKSKREKREMIIEESVKTHKPILFEEKLNQETIIKTDQRSNVESPPVEINRN
ERREEAGRELGFSIICKTENSSPMILKGISVKQDVLTFFKPNQVTEEEGKNLSPSLRPEE
DLSQISVVAQSEPFSSTTRRPEGLYYQESVGKAQVASKSQISESNKPFQGDIRLETNSYQ
DSWITFKTKETKDLICSSNEYKERSYQEVPFDSTGTLKLEKSTVSTVDSKEASYLEFSHS
KDYHHQDSKSDSEICGILTSKIITTQEMTGEKFLEMSNPIDTGVEAASFEGMVTQGVPTV
LASLLPEKLFKDVSQKERAEQQDATISSTIPETSEEKPVPLPYPTVKMDEKTPQEKLKES
PGGEQTPFMTTAGGRGNEGVNPEPSRTAKNVFNRQLCLEHDEKLVSYLSLLRDIEMRTKQ
IQPLDLNLAELQDLLCQAKVLDRELKDLSTLVNQELECVNQIIISQPQEVPAQLLKALEK
DAKNLQKSLSSVSDTWSSRLLHLQSAVEVKKTRVLNQYEQLKGRLQDLRAWVGSITLLLD
SEGCNNETDTDSLKHHLQQYKDLKQPMAERKSQLDALAFDTQFFISEHAQDLSPQQNRQV
LSLLSELQRSFQDLVEQTAAPMDALQGHFQQMEQAAQVKTLQKQQNTCHQKLEDLCNWLG
RAESALTGHQGRATQQDLSALQKNQSDLKDLQDDIQSRAASFASVVKDIEGFLEENQAKL
SPHELTALREKLHQAKEQYEALQERTRVAQKELEEVVTSAVQQETEKSKAAKELAENRNK
IDALLDWVTAVRSEGQMEQLSGTSLGKGAFDTTDAHKGASQAPEELDKQCEKMKARHQEL
LSQQQNFILATQSAQAFLAQHGHNLTPEERQVLQDKLGELKGQYATSLAKSEAELKQAQT
LRDELQKFLQDHQEFENWLERSERELENMHKGGSCPEALPSLLKRQGSFSEDVISHKGDL
RFVTISGQKVLDTENSFEEGREPSATGDLVKGKLKDATERYTALHSKCTRLGSHLNMLLG
QYQQFQSCTDSLKAWMQACEASVEKLLSDTVASDPGVLQQQLATTKQLQEELAEHQVPVE
KLQKVAHDLMEIEGEPAPDCKHVQETTDSILSRFQNLSSSLAERSALLQKAIARSQSVQE
SLESLLQSIREVEQNLEEEQVASLSLGVIQEALATNMKLKQDIARQKSSLEATREMVTRF
METADSATAAVLQGKLAEVSQRFEQLCLRQQEKENSLKKLLPQAEMFEHLSDKLQQFMEN
KSRMLASGNQPDQDIAHFFQQIQELNSEMEDQQENLETLEHLVTELSSSGFALDLSLHQD
RVLNLRKDFTELQKTVKEREEDASSCREQLDEFRKLVRTFQKWLKETEGNIPPAETFMSM
KELEKQIEHLKYLLDDWASKGSLVEEINCKGTSLENLIMEITAPDSQAKTGSILPSVGSS
IGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGAVLRERQESLQSVLSRMQEVQKEAGSVLQ
WLESKEEVLKAMDTSSSPTKPETVRAQADSNKAFLAELEQNSPKIQKVKESLAGLLMAFP
NSQEAENWKEMQEELNSRWERATEVTMARQKQLEESASHLASFQTAESQLRPWLMEKELM
MGVLGPLSIDPNMLTAQKQQVQFMLKEFEARRQQHEQLNEAAHGILTGPGDVSPSTSQVQ
KELQSINHKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDLSEKVKAVGQRLSSQAAIST
QPEAVKQQLEETSEIRSDVEQLDHEIKEAQTLCDELSVLIGEQYLKDELKKRLETVALPL
QGLEDLAADRMNRLQAALASTQQFQQMFDELRTWLDDKQSQQAKNCPISAKLERLQSQLQ
ENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEKKTLQNQLVELKSHWEELSKKTADR
QSRLKDCLQKAQKYQWHVEDLVPWIEDCKAKMPDLQVTLDPVQLESNLLRSKAMLSEVEK
RRSLLEILNSAADILINSSETDEDDIRDEKAGINQNMDSITEELQTKTGSLEEMTQRLKE
FQESFKNIEKKVEAAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQTLEPQVDYLRNFTQ
GLVEDAPDGSDASQLLHQAEVTQQEFLEVKQRVNSGCMAMENKLEGIGQFHCRVREMFSQ
LADLDDELDSMGAIGRDTDSLQSQIEDVRLFLHKIQALRLDIEASEAECRQMLEEEGTLD
LLGLKRELEALNKQCGKLTERSRARQEQLELTLGRVEDFYRKLKALNDMTTAAEEGEALQ
WVVGTEVDLINQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGKNCDVQGLEHDME
EINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELIANQKPPSAEYKV
VKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQLEGLESRWTGLLS
KAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTAKIQQQITRHKAL
EEEIESHATDVHQAVRIGHSLSSLTCSAEQGMLSEKLDSLQARYSEIQDWGCRKAALLEQ
ALCNARLFGEDEVEVLNWLAEVEDKLSSVFVKDYRQDVLQKQHADHLALNEEIINRKKNV
DQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLEQARQLATKFQST
YEELTGWLREVEEELAASGGQSPTGEQIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALL
ELVPWRAREGLDKLVSDANEQYKLVSDTVGQRVDEIDAAIQRSQQYEQAADAELAWVAET
KRKLTALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRGEIFGTCGEEQKAVL
QEKTESLIQQYEAISLLNSERYTRLERAQVLVNQFWETYEELSPWIEETRALITQLPPPA
IDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGEMVEEKYQKAENLYA
QIKEEVRQRALALDEAVSQSAQIAEFHDKIEPMLETLENLSSRLRMPPLIPAEVDKIREC
ISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKA
RAEEREIKFLDVLELAEKFWYDMAALLTTIRDTQDIVHDLESPGIDPSIIKQQVEAAETI
KEETDGLHEELEFIRILGADLIFACGETEKPEVKKSIDELNNAWESLNKTWKERLEKLED
AMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEM
EKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKLEGALLALGQFQH
ALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQATVETVNKAGNEL
LESSAGDDASSLRSRLETMNQCWESVLQKTEEREQQLQLTLQQAQGFHSEIEDFLLELTR
METQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGS
KTEQSVALLEQKWHVVSTKMEERKSKLEEALNLATEFQNSLQEFINWLTLAEQNLNIASP
PSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQS
RWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQ
LSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLPDDTQKLDNLLGEVRDKWDTVCGKSV
ERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKE
LGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQ
AEEFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKKVEEKRADVSTAV
AMGEAILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALSELVANAELLEEL
LAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNVE
PAHTPFIEKSRSGSRKSLNQPTPPPMPILSQSEAKNPRINQLSARWQQVWLLALERQRKL
NDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGI
LASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQV
AQCKCAKRFQVEQIGENKYRFFLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVK
NDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHS
CTSMPSSPATPASGTKTPLQFSRCYDKPWLVNSKAGTPVRDSHYPDLQLPSPEVIPSTGS
KLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSR
RGSDASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPK
R
Download sequence
Identical sequences M3YSL3
ENSMPUP00000014323 ENSMPUP00000014323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]