SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014387 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014387
Domain Number 1 Region: 210-276
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.98e-20
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 151-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.15e-18
Family LIM domain 0.00083
Further Details:      
 
Domain Number 3 Region: 29-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000011
Family LIM domain 0.021
Further Details:      
 
Domain Number 4 Region: 89-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000137
Family LIM domain 0.0023
Further Details:      
 
Domain Number 5 Region: 273-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000335
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014387   Gene: ENSMPUG00000014497   Transcript: ENSMPUT00000014619
Sequence length 301
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:10554030:10556211:1 gene:ENSMPUG00000014497 transcript:ENSMPUT00000014619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATARLSDPCPTFGTWQGSLTATMSEAFDCAKCSESLYGRKYIQTDDGPYCVPCYDSTFAN
TCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCKRSLADEPFTCQDNELLCNDCYCSAFS
SQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKF
APRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDDDPYCVACFGELFA
PKCSSCKSPITGLGGGKYVSFEDRHWHHSCFSCARCSTSLVGQGFVPDGDQVLCQGCSQA
G
Download sequence
Identical sequences M3YSS7
ENSMPUP00000014387 ENSMPUP00000014387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]