SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014388 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014388
Domain Number 1 Region: 16-190
Classification Level Classification E-value
Superfamily RUN domain-like 3.79e-41
Family RUN domain 0.0012
Further Details:      
 
Domain Number 2 Region: 664-754
Classification Level Classification E-value
Superfamily PX domain 7.85e-25
Family PX domain 0.00071
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014388
Domain Number - Region: 510-545
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0745
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014388   Gene: ENSMPUG00000014498   Transcript: ENSMPUT00000014620
Sequence length 822
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:5564018:6022026:-1 gene:ENSMPUG00000014498 transcript:ENSMPUT00000014620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPRCILGSQNNDLKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQ
HGLKRSRGLALTAAAIKQAAGFASKTETEPVFWFYVKEVLSKHELPRFYSLRHIASDVGR
GRAWLRCALNEHSLERYLHTLLADRGRLSAFYEDWSFVMDEERSSMLPTMAAGLNSILFA
INIDNKDLNGQSKFAPTVSDLLKESTQNVTSLLKESTQGVSSLFREITASSAVSILIKPE
QDTDPLPVVSKHVSADAKCRKERKKKKKVTNIISFDDEEEEQNSGDVFRKIPGAGESSEE
NSDRSSVNIMSAFESPFGPNSNGSQSSSSWKMDSLSLNGECGYQKLDVKSIDDEDVDDNE
DDVYGNVSGRKCLGHSGSPEKPLDGDTHLSQMHSWAPLQVLHGDADVLFPVSGVGSYSPA
DAPLGSLENGTGPEDHVLPEPGPRYSVEASPPSQGSPLSNLLPSASVPESMTISELRQAI
VAMMNRKDELEEENRSLRNLLDGEMEHSAALRQEVDTLKKKVAEQEERHVLKVQALAREN
EVLKVQLKKYVGAVQMLKREGQAAEVVPNLWSVDGEVTVTEQKPGEVAEELASSYERKLI
EVAEMHGELIEFNERLHRALVAKEALVSQMRQELIDLRGPVPGDLSQTSEDQSLSDFEIS
TRALINVWIPSVFLRGKAANAFHVYQVYIRIKDDEWNVYRRYTEFRSLHHKLQNKYPQVR
GYNFPPKKAIGNKDAKFVEERRKQLQNYLRSVMNKVIQVAPEFAASPKKETLVQLMPFFV
DVPPPGEPLTKNTRPKVASRFPKLSRGHPRETRNVEPQSGDL
Download sequence
Identical sequences M3YSS8
ENSMPUP00000014388 ENSMPUP00000014388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]