SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014467 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014467
Domain Number 1 Region: 272-331
Classification Level Classification E-value
Superfamily FF domain 1.44e-16
Family FF domain 0.0000756
Further Details:      
 
Domain Number 2 Region: 486-558
Classification Level Classification E-value
Superfamily FF domain 0.00000000000133
Family FF domain 0.0048
Further Details:      
 
Domain Number 3 Region: 403-478
Classification Level Classification E-value
Superfamily FF domain 0.00000000000706
Family FF domain 0.0039
Further Details:      
 
Domain Number 4 Region: 627-689
Classification Level Classification E-value
Superfamily FF domain 0.0000000000235
Family FF domain 0.00015
Further Details:      
 
Domain Number 5 Region: 97-130
Classification Level Classification E-value
Superfamily WW domain 0.000000000904
Family WW domain 0.00096
Further Details:      
 
Domain Number 6 Region: 138-169
Classification Level Classification E-value
Superfamily WW domain 0.00000000757
Family WW domain 0.0015
Further Details:      
 
Domain Number 7 Region: 336-405
Classification Level Classification E-value
Superfamily FF domain 0.00000109
Family FF domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014467   Gene: ENSMPUG00000014578   Transcript: ENSMPUT00000014700
Sequence length 872
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897186.1:520179:539911:-1 gene:ENSMPUG00000014578 transcript:ENSMPUT00000014700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPPPFMPPPGIPPPFPPMGLPPMSQRPPAIPPMPPGIMPPILPPMGAPPPLTQIPGMVP
PMMPGMLMPAVPVTAATAPGADTASSAVAGTGPPRALWSEHVAPDGRVYYYNADDKQSVW
EKPSALKSKAELLLSQCPWKEYKSDTGKPYYYNNQSKESRWTRPKDLDDLEALVKQEAAG
KQPQQPQILQPQPPQPQPEPPPGPPGPTPVPLGLLEPEPGGSEDCDMSEAAQPVEQGFLQ
QPEEGPSSAAGQHQPPQQEEEESKPEPERSGLSWSNREKAKQAFKELLRDKAVPSNASWE
QAMKMVVTDPRYSALPKLSEKKQAFNAYKAQREKEEKEEARLRAKEAKQTLQHFLEQHER
MTSTTRYRRAEQTFGELEVWAVVPERDRKEVYDDVLFFLAKKEKEQAKQLRRRNIQALKS
ILDGMSSVNFQTTWSQAQQYLMDNPSFAQDHQLQNMDKEDALICFEEHIRALEREEEEER
ERARLRERRQQRKNREAFQTFLDELHETGQLHSMSTWMELYPAVSTDVRFANMLGQPGST
PLDLFKFYVEELKARFHDEKKIIKDILKDRGFCVEVNTAFEDFAHVISFDKRAAALDAGN
IKLTFNSLLEKAEAREREREKEEARRMRRREAAFRSMLRQAVPALELGTAWEEVRERFVC
DSAFEQITLESERIRLFREYLQVLETECQHLHTKGRKHGRKGKKHHRKRSHSPSGSESEE
EELPPPSLRPPKRRRRNPSESGSEPSSSLDSVESGGAALGGRGSPSSRLLLGSDHGLRKA
KKPKKKTKKRRHKSNSPESETDPEEKAGKESDEKEPEQDKDRELRRAELPNRSPGFGIKK
EKTGWDTSESELSEGELERRRRTLLQQLDDHQ
Download sequence
Identical sequences M3YT07
ENSMPUP00000014467 ENSMPUP00000014467 XP_012904611.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]