SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014500 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014500
Domain Number 1 Region: 288-682
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.05e-120
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 4-62
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000107
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014500   Gene: ENSMPUG00000014610   Transcript: ENSMPUT00000014733
Sequence length 682
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:5347949:5382468:1 gene:ENSMPUG00000014610 transcript:ENSMPUT00000014733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVK
MLAESDESGDEEAVSQTDKTELQNTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESL
RLPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLE
ETLEQLAKQHNHLERAFRGATVLPANTPGSAGSGKDQCCSGKGDMSDEDDENEFFDAPEI
ITMPENLGHKRTGSNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLWSIMKN
CIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYS
TTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKI
TSKFRGKYLSIMPLGSIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKT
GDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQPVVGENGGD
ARQRGHEAEESRVMLWKRNPLPKNAENMYYFSELALTLNAWESGTAPTDSRLRPDQRLME
NGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTPYDPYKALWFERKKDPVTKELTH
IYRGGYWECKEKQDWTSCPDIF
Download sequence
Identical sequences M3YT40
ENSMPUP00000014500 ENSMPUP00000014500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]