SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014512 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014512
Domain Number 1 Region: 299-377
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.41e-23
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 71-103
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000146
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014512
Domain Number - Region: 76-160
Classification Level Classification E-value
Superfamily Malate synthase G 0.0288
Family Malate synthase G 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014512   Gene: ENSMPUG00000014621   Transcript: ENSMPUT00000014745
Sequence length 419
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:178339:194848:1 gene:ENSMPUG00000014621 transcript:ENSMPUT00000014745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSHSFSQTPSGSLRGTGGSWGQLGKFPRAPSVHGGAGGVRISLSFSSPRCLPPGGPWG
SRRGNSLPAASGKEVMQNLNDRLASYLDKVRALEEANEKLERRILKWHEQRDPGSKQNYS
KYEENINHLQEQIMDGKMTNAQIILLIDNARMAVDDFGLKYENEHSFKKDLETEVEGLRK
TLDDLTIVTTDLEQEVEGMRKELILMKKRHEQEMEEHHVPNDFKVSVKVDTTPGEDLIKV
LEDMRQEYEYIIKKKHQDLDAWYKEQSATMAQEVASPAAVQSSQSDIHELKRTFQALEID
LQAQHNRKSALENMLSETQSRYSCQLQDMQRVISHYEEELMQLRHDLERQHNEYKVLLGI
KTHLEKEIATYHQLLEGKSEGTMEESKSSVEAPKIKAITQESVNGRIILSQVNEIQKCA
Download sequence
Identical sequences M3YT52
ENSMPUP00000014512 XP_004764634.1.14098 ENSMPUP00000014512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]