SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014534 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014534
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000329
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014534   Gene: ENSMPUG00000014643   Transcript: ENSMPUT00000014767
Sequence length 518
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:24162049:24215514:-1 gene:ENSMPUG00000014643 transcript:ENSMPUT00000014767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METWSVDQVCSWLVEKNLGELVHRFQEEEVSGAALLALNDRMVQQLVKKIGHQAVLMDLI
KKYKQKSQRLEPLGSLRETASLAQAGAAREDEQFPSPDNCGQQTPSFYAAENLENGLVDQ
RVLKQRRNVKHVLARTKALQWTQSYVLPEFPYDVKCMLAEQKCPDHSMRIRIIEFLQADM
TKYLEGSLYPSTQQYNDVVNALLQAHPFLDEDGCGFFLWKRALKDRFKYVRRPIEDDEQV
MRNKCKFGHRRGQTKKSLTNISFDEVKIVQIKEETVCLDSETDEHINWFQQEYMKTEKNW
KEIDKRMSQTLEIRRKLIGSRTPLKDVLKMFPFLKCPYQMFREFQLLTRTDIYKKIKHIL
ESYSENILTSFSVMDNPINIALQEKMKQHTDEEMLKHLKMTATCLLLPDVFGDDPSLFVI
VNEKVQVSTPVLEVKNPFNVDVCEFSLYLEKEKLTKVDDCITALAALIAAFHVFGVECPR
RLSQTLNFLETLIFDMHSPGFPSMKEKEKEVGFQHPVT
Download sequence
Identical sequences M3YT74
ENSMPUP00000014534 ENSMPUP00000014534 XP_012919120.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]