SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014536 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014536
Domain Number 1 Region: 394-537
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 290-395
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-35
Family Second domain of FERM 0.00000416
Further Details:      
 
Domain Number 3 Region: 210-289
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-26
Family First domain of FERM 0.0000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014536   Gene: ENSMPUG00000014645   Transcript: ENSMPUT00000014769
Sequence length 914
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:24769716:24980754:-1 gene:ENSMPUG00000014645 transcript:ENSMPUT00000014769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKESEPLGADATKEKPKEVAENQQNQSSDPEEEKRSQSSPTAESQSSSR
RQKKERDPSESRGISRFIPPWLKKQKSYTLVAAKDGGDKKEPAQAAVEEVLDQEESLPEG
ERQAKGDVEETSQRKQQEVKVDVKEEKPSVSRAEAQPAGEVRKEREEKVKEMQEDKSEEA
AKRETKEVQTNELKAEKSSQKASKKTKAVQCKVILLDGTEYSCDLEKRAKGQVLFDKVCE
HLNLLEKDYFGLLFQESPEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDLT
RYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSSDLSDFQFAPTQTK
ELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLL
IYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCV
EHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRVSR
SLDGAPVGVMDQSLMKDFPGPAGEVSAYGPRVVSTAVVQDGDGRRDLRSPTKVPHVQFIE
GKKNSLRVEGDNIYVRHSNLMLEDLDKAQEDILRHQASISELKRNFMESTPEPRPNEWEK
RRITPLSLQTQGRKGDHLFKDILSVKEKHQMAATRTVEEKVQEADKSLEEEITSILFSGK
GFSDSLRATFTSATTWTAEGTVVNCNTPEKLSSSPFSQLPEKRAPESEGPCSGACDAVEP
PVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAGGDSGTLLTAQTITS
ESVSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIREAREQHPDMSVTR
VVVHKETELEEGEE
Download sequence
Identical sequences M3YT76
ENSMPUP00000014536 ENSMPUP00000014536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]