SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014555 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014555
Domain Number 1 Region: 335-630
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-90
Family Protein kinases, catalytic subunit 0.0000000194
Further Details:      
 
Domain Number 2 Region: 157-284
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.11e-36
Family Synaptotagmin-like (S variant) 0.000000996
Further Details:      
 
Domain Number 3 Region: 25-87
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.99e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 99-154
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.04e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014555   Gene: ENSMPUG00000014664   Transcript: ENSMPUT00000014788
Sequence length 688
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:12521317:12906481:1 gene:ENSMPUG00000014664 transcript:ENSMPUT00000014788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRRQTSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMVDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVTFCTKMHWLQWASRPSCGKGAENFDKFFTRGQPVLTPPDQLV
IANIDQSDFEGFSYVNPQFVHPILQSAV
Download sequence
Identical sequences M3YT95
ENSMPUP00000014555 ENSMPUP00000014555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]