SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014585 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014585
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 8.63e-38
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 2 Region: 252-361
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-21
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 3 Region: 133-231
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-18
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014585   Gene: ENSMPUG00000014694   Transcript: ENSMPUT00000014818
Sequence length 381
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:6303580:6331332:1 gene:ENSMPUG00000014694 transcript:ENSMPUT00000014818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDRERNKKRLLELLQAAGTGNAHCADCGAADPDWASYKLGIFICLNCSGVHRNFPDISK
IKSVRLDFWDDSTVEFMTHNGNLRVKAKYEARVPAFYYVPQANDCLVLKEQWIRAKYERQ
EFMADGKTTSPPGNREGFLWKRGRDNAQFLRRKFVLLAKEGLLKYYTKEEGKGPKAVISI
KDLNATFETEKIGNPHGLQITYRREGHVRNLFVYHESGKEIVDWFNALRAARLQYLKTAF
PELPESELVPLITRKYLKQGFMEKTGPKQKEPFKKRWFVLDPQERRLLYYKNPLDAFEQG
QVFLGSNEQGYGVYEDLPKGIRGNRWKAGLTIVTPERRFLFTCPSEKEQREWLESFQDVL
SRPLTPLNLLTASSESGHSSR
Download sequence
Identical sequences M3YTC5
ENSMPUP00000014585 ENSMPUP00000014585 XP_004747118.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]