SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014619 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014619
Domain Number 1 Region: 490-807
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-85
Family Protein kinases, catalytic subunit 0.00000151
Further Details:      
 
Domain Number 2 Region: 303-403
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 3.79e-43
Family MAST3 pre-PK domain-like 0.0000128
Further Details:      
 
Domain Number 3 Region: 1061-1153
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-19
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014619   Gene: ENSMPUG00000014728   Transcript: ENSMPUT00000014852
Sequence length 2534
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897005.1:3704625:4272639:-1 gene:ENSMPUG00000014728 transcript:ENSMPUT00000014852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFRKCSNPDVTSGPAKSLKFKRQLSEDGRELRRGSLGGALTGRYLLPNPVAGQAWPASA
ETSNLVRMRSQALGQSAPSLTASLEGQPPKSHFNSARHRQRLVDPAASKKELSLPRRGSF
LTPRSLSPTPSSPGSPCSPLFAFHFWSCRTSNRKSLIGNGQSPALPRPHSPLSAHAGNSP
QDSPRNFSPSASAHFSFARRTDGRRWSLASLPSSGYGTNTPSSTVSSSSSSQEKLHQLPY
QPTPDELHFLSKHFCTTESIATENRCRNTPMRPRSRSLSPGRSPACCDHEIIMMNHVYKE
RFPKATAQMEERLKEIITSYSPDHVLPLADGVLSFTHHQIIELARDCLDKSHQGLITSRY
FLELQHKLDKLLQEAHDRSESGELAFIKQLVRKILIVIARPARLLECLEFDPEEFYYLLE
AAEGHAKEGQGIKSDIPRYIISQLGLNKDPLEEMAQLGNYDSGTAETPETDESVSSSNAS
LKLQRKPRESDFETIKLISNGAYGAVYFVRHKESRQRFAMKKINKQNLILRNQIQQAFVE
RDILTFAENPFVVSMYCSFETRRHLCMVMEYVEGGDCATLMKNMGPLPVDMARMYFAETV
LALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEGHIEKDAREF
LDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISD
EINWPEKDEAPPPDAQDLITLLLRQNPLERLGTGGAYEVKQHRFFRSLDWNSLLRQKAEF
IPQLESEDDTSYFDTRSEKYHHMETEEEDDTNDEDFNVEIRQFSSCSHRFSKVFSSIDRI
TQNSGEEKEDPGDKTKSTVLPSTETFSWSSEYSEMQQLSTSNSSDTESNRHKLSSGPLPK
LAISTEAEKDEAAPCPRDLSEEPEKPSLPPAECTQEEPEVTTPASTISSSTLSVGSFSEH
LDQINGRSECVDSTDNSAKPSSEPASHMARQRLESTEKKKISGKVTKSLSASALSLMIPG
DMFAVSPLGSPMSPHSLSSDPSSSRDSSPSRDSSAASASPHQPVVIHSSGKNYGFTIRAI
RVYVGDSDIYTVHHIVWNVEEGSPACQAGLKAGDLITHINGEPVHGLVHTEVIELLLKSG
NKVSITTTPFENTSIKTGPARRNSYKSRMVRRSKKSKKKESLERRRSLFKKLAKQPSPLL
HTSRSFSCLNRSLSSGESLPGSPTHSLSPRSPTPSYRSTPDFPSGTNSSQSSSPSSSAPN
SPAGSGHIRPSTLHGLAPKLSGQRYRSGRRKSAGSIPLSPLARTPSPTPQPTSPQRSPSP
LLGHSLGNSKIAQAFPSKMHSPPTIVRHIVRPKSAEPPRSPLLKRVQSEEKLSPSYGSDK
KHLCSRKHSLEVTQEEVQREQPQREVTLQSLEENVCDAPSLSRARPVEQGCLKRPVSRKL
GRQESVDELDREKLKAKVVVKKPDGFLEKQEPQQKSHGLGSDLENLSTLRLEEREKKIYP
KALERSNHFENKGALQETQSLGSLLKGALHKQASVRVSEGVTSEGAATGHVLGPGDHSQG
ICDFKRTSAASTLQDSLCHSTDRSSSTKGENVEKASQAKDCLRCEKLDSKLANIDYLRKK
VSLEDKDDSPCSVLKPKMTSSAHESLPGNPVRAVGGQQEALPASESRAFISSAHPAQISA
AAFVPLKALAGRVDGGGEKPGLVAPESPVRKSPSEYKMEGRSVSCLKPIEGTLDIALLSG
PQASKTELPSPEPAQSPSPASDVEPSVPPALPSGGGMKGDTAGQREPSSASFRMSKSYLL
ESRFPSSSRALQNSPAASLPEPDIKRDRKASHAARSPVTVMESNPQQKEGGPSKHQDHSP
DIKLLPFLGQNPHSTDPSRSRSLLPPESTPSREKLSGRESSERGPSAARGERSALRVDSQ
RDPSTELCPPEAAKTRDDSRNLPSGGRPRPDCYTQPHPTQKAWGSCGKASPRDGRVEVRP
LAREDSHLPSAGTLEKELGRGRGGTEPQPEAPPARRSQPPPGPENGRGDLLSGFPVLPRD
SPKELEGKEQPPQKHVSGSSQPVPVTKELHGLAARPHSSSLSHGSGGEPGGKPCAAEPGP
GLQGPPKPTTAHRESSSHKPRPGPDPSPPKSKHPDRALSSQKLSSGPAVGREPGSQPPAG
PSREGKGCSKSISDAFPALPGSQNTVSDAMGQGGGGPSVPLQAEGGLLDTRLKPTSLGHP
PEGLEKPTLLPWQRRPGVDELVDQKPATVSEKQNLSPKHPKPSTVKDCPPLCKQTDVSPS
SLATTTTDRKSEGKKCTEALYVATESGKPEASLPLASSEARPKGTERPAAAVGKGLSEAK
GKGLSAQKPLNEAGKPSGMKRSPSATGQSSLRSTALPEKSLSYSSSFPEARPGAREATTS
GSDASSTKAGGAAAKALPGGDGRTHMTKSDSLPSFRSPTVTLELHHPGPSVAGGAGHRDR
ALSVTATAGETKGKEPVPTQPPQTRKQNPGREVTKASPAPNPDRPITLSSEKDFVVRQRR
GKESVRSSPHKKAS
Download sequence
Identical sequences M3YTF9
ENSMPUP00000014619 ENSMPUP00000014619 XP_012917915.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]