SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014624 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014624
Domain Number 1 Region: 370-732
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.27e-128
Family Hect, E3 ligase catalytic domain 0.00000000332
Further Details:      
 
Domain Number 2 Region: 3-128
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.42e-22
Family PLC-like (P variant) 0.037
Further Details:      
 
Domain Number 3 Region: 282-322
Classification Level Classification E-value
Superfamily WW domain 0.000000000000428
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 144-183
Classification Level Classification E-value
Superfamily WW domain 0.0000000000145
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 236-277
Classification Level Classification E-value
Superfamily WW domain 0.000000000267
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014624   Gene: ENSMPUG00000014733   Transcript: ENSMPUT00000014857
Sequence length 739
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:14092305:14147212:1 gene:ENSMPUG00000014733 transcript:ENSMPUT00000014857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYFFVSFTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYI
GKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVR
GQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPT
RPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDSRLAERRVRSQRHRNYMSRTHLHT
PPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNTA
TGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDAECLTVPRYK
RDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGE
EGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRI
MGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTF
CVEHNAYGEIIQHELKPNGKSIPVTEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVI
PQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNVVKWFWKAVEFFDEERRA
RLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESYE
KLYEKLLTAIEETCGFAVE
Download sequence
Identical sequences M3YTG4
XP_012909983.1.14098 ENSMPUP00000014624 ENSMPUP00000014624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]