SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014633 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014633
Domain Number 1 Region: 184-378
Classification Level Classification E-value
Superfamily L domain-like 5.78e-40
Family Leucine rich effector protein YopM 0.012
Further Details:      
 
Domain Number 2 Region: 22-220
Classification Level Classification E-value
Superfamily L domain-like 4e-38
Family Leucine rich effector protein YopM 0.025
Further Details:      
 
Domain Number 3 Region: 1341-1432
Classification Level Classification E-value
Superfamily PDZ domain-like 3.46e-21
Family PDZ domain 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014633   Gene: ENSMPUG00000014742   Transcript: ENSMPUT00000014866
Sequence length 1435
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897005.1:4673743:4797651:-1 gene:ENSMPUG00000014742 transcript:ENSMPUT00000014866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEE
LPKQLFNCQSLHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTVV
EASVNPISKLPDGFSQLLNLTQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTM
NRLTQLERLDLGSNEFTEVFIGSLKQLTYLDVSKNNIEMIEEGISACENLQDLLLSSNSL
QQLPETIGSLKNVTTLKIDENQLMYLPDSIGGLVSIEELDCSFNEVEALPSSVGQLTNIR
TFAADHNYLQQLPPEIGSWKNITVLFLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPF
SFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKMVLTNYMFPQQPRTEDVMFISDNESF
NPSLWEEQRKQRAQVAFDCDEDKDEREAPPREGNLKRYPTPYPDELKNMVKTVQTIVHRL
KDEETCEDSGKELKPHEDQQVVNNDVGVKTSESTTPVRIKADEREKYMIGNSLQKTSESE
AEISPGSLPVTTNMKASENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIESSINQPK
VVALSNNKKDDTKDTDSLSDEVTHNSNQNNSNCSSPSRMSDSVSLNTDSSQDTSLCSPVK
QTHIGINSKIRQEDENFNSLLQNGDILNHSTEEKFQLHDKKDINLPEYDLNIEEQLVLIE
KSVDSAATSDESHKLDHINMNLNKLVTNDTFQPEIVERSKTQDIVLGTDFLSINSKGEAE
PLENGNKYSNLECVNKINGHSEETPQSARRTEPHGTDSSVDMGVSKSTEDLSPQRSGPIG
SVVKSHSITNMETGGLKIYDILSDNGPQQPSATIKVTSTVDGKNIVRSKSATLLYDQPLQ
VFTGSSSSTDLISGTKAVFKFDSNHNPEEPNIIRSPTVSGPQPMPQMYGPPQYNIQYSSS
AAVKDTLWHTKQNPQIDHVGFPPQRLPRSESTESHSYAKHSANMNFSNHNNVRANTGYHL
HQRVGPGRHGEMWAISPNDQLIPGATRTTIQRQSSVSSTASVNLGESGPTRRAQIPEGEY
LSYRELHSAGRTPVMSGSQRPLSARTYSIDGPNTSRPQSARPSISEIPERTMSVSDFNYS
RTSPSKRPNARVGSEHSLLDPPGKSKVPHDWREQVLRHIEAKKLEKSMLSRSFNSNFTAV
SNFHYGSSRDLHGSQGSLALSVADGRGSGGHIFRHPQTSCPGDPCQDDIFLSGQPNYSSA
TLSHKDVPPDSLMKMPLINGQMGQPLRPQANYSQIHHPLPQASVARHPSREQLIDYLMLK
VAHQPPYTQPHCPPRQGHELARQEIRVRVEKDPELGFSISGGVGGRGNPFRPEDDGIFVT
RVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS
Download sequence
Identical sequences M3YTH3
ENSMPUP00000014633 XP_012917918.1.14098 ENSMPUP00000014633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]