SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014674 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014674
Domain Number 1 Region: 85-158
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-21
Family SH3-domain 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014674
Domain Number - Region: 502-557
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014674   Gene: ENSMPUG00000014783   Transcript: ENSMPUT00000014907
Sequence length 571
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:11913545:11926189:-1 gene:ENSMPUG00000014783 transcript:ENSMPUT00000014907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRPLSLSSDSRSPCQISGPPKMVQGELQLHPRAGRRAEAASWGDCGSDKGGLGNPDMPSV
SPGTQRPPKLSSLTYDSPPDYLRTVSRPEIYRVLFDYQPEAPDELALRRGDEVKVLRKTT
EDKGWWEGESQGRRGVFPDNFVLPPPPVKKLTPRKMVSRESAPIKEPKKVTPKSALPTVR
KLVTAPPGPSKAKPSWTPSGDSQKRPSRDLGSGGSFLSGGPGHPGRKGPKTQASRQRSAT
SQEEEQSSLAKASPVNKTPTLDKTPSPEKTLSPDKAPTPEESLTPEGSLTLEFKAPALGN
PTPQEGLTLDKAPSPNSLISVDVAPAPEVPPEDELLGPKMVPPGDEVSTLEKVLTPEQVL
SEEASTRDNTQFHHFSPEQALPKFTSPVANEARSQEVHMPEKADLCMMTHPLDQSNSSPF
QSKSKPGSMPALEKATTLLQEAPGKHEGTPQEAALPKEEVAPKEVDPALKNPHSIKSTPD
PQETPTPLSLVPQNLTDSKSDRGDIMRLQDEMESLRRSLERMGVQLERKLTDIWEELKSE
KEKRRLLEVQMKQGTRESRTLGSIHAQTQTH
Download sequence
Identical sequences M3YTL4
ENSMPUP00000014674 ENSMPUP00000014674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]