SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014680 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014680
Domain Number 1 Region: 33-181
Classification Level Classification E-value
Superfamily PH domain-like 4.24e-39
Family Phosphotyrosine-binding domain (PTB) 0.000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014680   Gene: ENSMPUG00000014789   Transcript: ENSMPUT00000014913
Sequence length 769
Comment pep:known scaffold:MusPutFur1.0:GL896898.1:38997797:39023009:1 gene:ENSMPUG00000014789 transcript:ENSMPUT00000014913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNEVETTTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDV
PDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNK
ISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVIDLKDLFQVIYNVKKKEEEKK
KMEEANKAVENGNETLLTLDDQANKLKLGVDQMDLFGDMSTPPDLNSPTESKDILLVDLN
SEIDTNQNSLRENPFLTNGITSCSLPRPKPQASFLPENAFSANLNFFPTPNPDPFRDDPF
AQPDQSAPSSFDSLKSSDQKKENLSNLSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQ
AGPWPFSSTQTQPTVRTQNGVSEREQNGFHFKSSPNPFVGSPPKGLSVLNGVKQDLESSV
QSSPHDSIAIIPPPQSTKPGRGRRTAKSPAKDLLASDIFTPPISEAPGQTSPTGQSATLQ
TNPLDLFKTNASAPAGPLAGLGGIPVSPPQAGPWNPASLVFNQSTSVVPGAMLSGQPSGF
SQPVVFTTSPAIPGWNQPSSFAASASPPAPVVWGPSASVVPNTWSSTSSLGNPFQSNIFP
ASAVSTQSPSMLSSLLVAPPQPPPRTGPPKDISSDAFTALDPLGDKEVKEVKEMFKDFQL
RQPPAVPARKGEQTSSGTSSAFSNYFNSKVGIPQENADHDDFDANQLLKKINEPPKPVPR
QGSLPVTKSADNAFENPFSKGSFGSSQASMASQPTSSDVYRDPFGNPFA
Download sequence
Identical sequences M3YTM0
XP_004738031.1.14098 XP_004738032.1.14098 XP_012907102.1.14098 XP_012907121.1.14098 ENSMPUP00000014680 ENSMPUP00000014680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]