SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014707 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014707
Domain Number 1 Region: 592-889
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.26e-52
Family WD40-repeat 0.0029
Further Details:      
 
Domain Number 2 Region: 1025-1080
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-21
Family SH3-domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014707   Gene: ENSMPUG00000014816   Transcript: ENSMPUT00000014940
Sequence length 1171
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:28650522:28858673:-1 gene:ENSMPUG00000014816 transcript:ENSMPUT00000014940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVESEAKVKTKVRFEELLKTHSELTDERKKLKKKMGKSGEKIALDTVRSNLLKSKETR
GDDVSPTSIDNSEESMQVTKSKLRNPQSTPENPDDVSVEEEKQGKTSKKAVKTVFQMTAQ
GMELETPVKKVDSTHQKARTRPQPGVAHQKSKKVDEERENSNLDEEEELLQLYQLQVAEE
MAKEIKKKIRKKLEEQLTYFPSDPSLHDGKLNSEKKIKKKKKVSMSSKAETSTLTISDDT
AESEQKKESPVRTVTSDSHQDEKISSVEDNVEDSMQDDTKSKPKKKKKKAKTVSGDNEDT
DGDGVHEVTSRDSPVYPKCLLDDDLVLGVYIHRTDRLKSDYMISHPMVKIHVIDENTGQY
VKKADSERPVSSHYEKENVDYILPIMTQPYDFKQLKSRIPEWEEQIIFNENFPYLLRDFD
ESPKVILFFEILDFLSMDEIRNNSEVQHQECGFRKIAWAFLKLLGANGNTNINSKLRLQL
YYPPSKHRSQLNIVEVFEWWSKYPRNHYPSTLYVTVRGLKVPECIKPSYHSVVTVQEEKG
KPVYCEGHHEAGSVDAEPGLEDSKEVVKWKRLPGQACRIPNKHLFSLNTGERGCFRLAFS
HNGRILAAACASRDGYPIILYEIPSGRFMRELCGHLNIIYDLCWSRDDRYILTASSDGTA
RIWKNEINNTNTFRVLPHPSFVYTAKFHPAVKEVVVTGCYDSVIRIWKVDMRGDPAILIR
QFDTHRSFINSLCFDIEGHHMYSGDCTGVIVVWNTYVKVNDVQHSVRHWSVNKEIKESEF
KGIPVSYLEVHPNGKRLLIHTKDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTFL
FAGSEDGIVYVWNPETGEQVAVYSDLPFKSPIRDISYHPLENMVAFCAFGQNEPILLYIY
DFHVAQQEAEMFKCYNGTFPLHGIYQSQDALRTFPKLPHQGSFQIDDCVHTERSSMRMQQ
VKQRLDSVTVNKNLSFSSTSASSQQSKLKQSDMLAAHQILPQSGFPQPGINSMERKPGNH
HVDTAPMVVALYDYTANRSDELTIHRGDIIRVFFKDNEDWWYGSIGKGQEGYFPANHVAS
ETLYQELPPEIKERSPPLTPKEKTKVEKPSSAAQKRPVKDKSQDFRLGSESVTHSEVGKE
QSREDQAHVMDMHLKKNEPSQRKSNPNRVKS
Download sequence
Identical sequences M3YTP7
ENSMPUP00000014707 XP_012919446.1.14098 ENSMPUP00000014707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]