SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014715 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014715
Domain Number 1 Region: 1-468
Classification Level Classification E-value
Superfamily Ras GEF 8.24e-119
Family Ras GEF 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014715   Gene: ENSMPUG00000014825   Transcript: ENSMPUT00000014949
Sequence length 472
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897141.1:1518975:1782680:1 gene:ENSMPUG00000014825 transcript:ENSMPUT00000014949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTPPFSAMFDSSGYNRNLYQAAEAGCAGLCYHDNNLLSGSLEALIQHLVPNVDYYPDR
TYIFTFLLSSRLFVHPYELMAKVCHLCVEHQRPSDPSSDKNQIRKIAPKILQLLTEWTET
FPYDFRDERMMRNLKDLAHQIASGEETYRKNVHQMIQGLVRKLATLSQYEEVLAKISSTS
TDRLTVLKTKPQSIQRDIITVCSDPYTLAQQLTHIELERLNYIGPEEFVQAFVQKDPLDN
DKSCYSERKKTRNLEAYVEWFNRLSYLVATEICMPVKKKHRARMIEYFIDVARECFNIGN
FNSLMAIISGMNMSPVSRLKKTWAKVKTAKFDVLEHQMDPSSNFYNYRTALRGAAQRSLT
AHSSREKIVIPFFSLLIKDIYFLNEGCANRLPNGHVNFEKFWELAKQVSEFMTWKQVECP
FERDRKILQYLLTVPVFSEDALYLASYESEGPENHIEKDRWKSLRSSLLGRV
Download sequence
Identical sequences M3YTQ5
XP_004777426.1.14098 XP_012903769.1.14098 ENSMPUP00000014715 ENSMPUP00000014715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]