SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014748 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014748
Domain Number 1 Region: 474-679
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 7.44e-49
Family ATP-dependent DNA ligase catalytic domain 0.00024
Further Details:      
 
Domain Number 2 Region: 689-832
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.64e-36
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00018
Further Details:      
 
Domain Number 3 Region: 90-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-31
Family PARP-type zinc finger 0.00000115
Further Details:      
 
Domain Number 4 Region: 258-499
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.0000000111
Family ATP-dependent DNA ligase DNA-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014748   Gene: ENSMPUG00000014859   Transcript: ENSMPUT00000014983
Sequence length 937
Comment pep:novel scaffold:MusPutFur1.0:GL896917.1:8741179:8758825:1 gene:ENSMPUG00000014859 transcript:ENSMPUT00000014983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLTFKILFPSALRALGRKELSLFREQYHWPDRRQFSHWLETDLLDGPCLLQRRKPALSF
QEGHLRPRATCLVFLPGAHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRI
GKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQISQ
HIADLSSKATGTPKKKAVVQAKLTATGQVTSPVKGASLVTNSNPRKFSGFSAKPDNSGAA
RASPPPKASLSSSRCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIQDFLRKGSAGDGF
HGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFE
QSKSFPPAAKSLLTIQEVDEFLLRLSRLTREEEQQQALQDIASRCTANDLKCIIRLIKHD
LKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLRNEQEVEKEPGRRRALSVQASLMT
PVQPMLAEACKSIEHAMKKCPNGMFSEIKYDGERVQVHKNGDHFNYFSRSLKPVLPHKVA
HFKDYIPQAFPGGHSMILDSEVLLIDTKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIY
FNDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKQVTKAADLADMINRVIREGLEGLVL
KDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPS
SQKWCTVTKCAGGHDDATLARLQKELDMVKISKDPSKIPSWLKINKIYYPDFIVPDPKKA
AVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKERADFT
VAAGEEGSSTTGGSSGENQGTLGPAAAHKASRASPKQPSTSAKKAGGRPSSPNSRGGHQR
TVKVGQKRKAPDETACPAKRRPASPHRGRRAVPAGRR
Download sequence
Identical sequences M3YTT8
ENSMPUP00000014748 ENSMPUP00000014748 XP_004747170.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]