SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014764 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014764
Domain Number 1 Region: 1656-1755
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-19
Family Plakin repeat 0.0074
Further Details:      
 
Domain Number 2 Region: 268-393
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000258
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 3 Region: 141-212
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000484
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 4 Region: 693-804,834-861
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000237
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014764
Domain Number - Region: 569-705
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000109
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014764   Gene: ENSMPUG00000014875   Transcript: ENSMPUT00000014999
Sequence length 1756
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:11656084:11699390:1 gene:ENSMPUG00000014875 transcript:ENSMPUT00000014999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQ
EGRQPEHRDVTLQKVSDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTSLRGK
HKQIYNLVVKEVDPQVNWAALVDEKLDKLSSQSFGTDLPLVDHQVEQHNIFHNEVKAIGP
HLAKDGGKEQNSELQAKYQKLLAASQARQQHLSTLQDYMQRCTNELYWLDQQAKGRMQYD
WSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSEGDQLLAAEHPGRNSIEAHMEAVHA
DWKEYLNLLICEESHLKYMEDYHQFHKDMKDAQDLLHKVDSDLNQKYNPDFKDQYQIELL
LRELDDQEKALDKYEHVVRSLQKRGQQVVPLKYRRETPLKPIPVEALCDFEGDQGLISRG
YSYTLQSNNGESWDLTDSAGNKLTAPAVCFVIPPTDPEALALADSLGGQYRSVRQKAARS
RSALQQRHEVLKKENPGDASDLQGRHLLAGLDKVARDLDRQEKAITAILRPPLEQGRAVQ
DSAERAKDLKNITNELRRIEPEKVRSIAECEEFVQALPGSGTAPLLKTRVEDTNRKYERL
VQLLDLAQEKVDVANRLEKSLQQGWEVLATYEKQLTQDDTVPESGRALDSKRQELATLAS
ELQAQKALLAEVERNLQAAKQCSSSLVSRFQEHCPDLERQEAEVLKLGQRSDNLRQQAEL
RAQSLQSAKAAYEDYRSGCDHVLQFLSHIPSYEPQETDSLSQMETKLKNQKNLLDEIARR
EEEVHTVCAHSQQYQQAVKDYELEAEKLRSLLDLENGRSSHVSKRARLQSPAAKVREEEA
ALAAKFTEVNAINRQRLQNLEFALSLLRQQPEVGASHESLQGSAPGSTADETWKVQKELD
EEIERRQQLEKEVKSAQEEIQTLKQRSPQEAVVKKEVLKKVPDPALEESFQQMQRSLSEE
QHKNRQLQEELEALRRRLRVLEQETGDGGQEYVVKEVLRIEPDRAQADEVLKLREELEEL
RRQKGTREAEVALLQQRVAALAEEKNRAQEKVTEKEVVKLQSDPQLEAEYRQLQEAQRRE
GKLREECEEELTFLQDKLKRLEKERAMAEGKITVKEVLKVEKDVATEREVSDLKRQYEDE
EAKARANQREKTELLRKIWALEEENARVLVQEKVREIVRPDPEAEREVADLRLELVEQER
KYRAAEEQLKSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKELQRLREEIVDKTR
LIERCDLEIYQLKQEIQSLKDTKPQVQTKEVVQEILQFQEDPQTKEEVQSLRTRLSEEQK
KQVDLERERASQEEKVRQKEEELSQVKEKVVQQEVVRYEEEPSLRAEVNAFTESIDVELR
QIDNLRGELRRLQRRRAELERQLEELERERQARREAELEVQRLKQRLADLEKEEGEAREK
VTLKQKVVLQQDPQQAREHSLLQVQLEEERHRRQVLESELETLKKKLVSLEQMQVKEKVV
FSESIQVDKGDTEQEIRKLKSSLEEESRSKRDLDAEVSRLEAKLSELEFYNSKSSKELDF
LREENHRLQLERQSLQLETRRLQSEIEMASTETRDLRNMTTADSGKNLDSRLWSLERELD
DLKRLSKDKDLEIDELQKRLGSVAVKREQRENHLRRSIVVIDPDTGRELSPEEAHRAGLI
DWNMFVKLRSQECDWEEISVKGPTGESSVIHDRKSGRKFSIEEALQKGRLTPAQYDRYVN
KEMSIQELAVLVSGQK
Download sequence
Identical sequences M3YTV4
ENSMPUP00000014764 ENSMPUP00000014764 XP_004750498.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]