SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014790 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014790
Domain Number 1 Region: 9-93,201-454
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-82
Family Ras GEF 0.00023
Further Details:      
 
Domain Number 2 Region: 101-209
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.08e-33
Family Ras-binding domain, RBD 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014790   Gene: ENSMPUG00000014901   Transcript: ENSMPUT00000015025
Sequence length 456
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:778190:793054:-1 gene:ENSMPUG00000014901 transcript:ENSMPUT00000015025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPEGLGRKQACLAMLLHFLDTYQGLLQEEEGAGRIIKDLYLLIMKDESLYQDLREDTL
RLHQLVETVELKIPEESQPPSKQVKPLFRHFRRIDSCLQTRVAFRGSDEIFCRVYMPDHS
YVTIRSRLSASVQDILGSVTEKLQYSEEPAGREDSLILVAVASSGEKVLLQPTEDCVFTT
LGINSHLFACTRDSYEALMPLPEEIQVSPGDTEIHRVEPEDVANHLTAFHWELFRCVHEL
EFVDYVFHGERGRRETANLELLLQRCSEVTHWVATEVLLCEAPGKRAQLLKKFLKIAAIC
KQNQDLLSFYAVVMGLDNAAVSRLRLTWEKLPGKFKNLFRKFENLTDPCRNHKSYREVIS
KMKPPVIPFVPLILKDLTFLHEGSKTLVDGLVNIEKLHSVAEKVRTVRKYRSRPLCLDME
ASPHHLQTKAYVRQFQVIDNQNLLFELSYKLEANSQ
Download sequence
Identical sequences M3YTY0
ENSMPUP00000014790 ENSMPUP00000014790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]