SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014791 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014791
Domain Number 1 Region: 615-825
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-47
Family DBL homology domain (DH-domain) 0.00058
Further Details:      
 
Domain Number 2 Region: 80-160
Classification Level Classification E-value
Superfamily F-box domain 2.62e-17
Family F-box domain 0.0011
Further Details:      
 
Domain Number 3 Region: 848-957
Classification Level Classification E-value
Superfamily PH domain-like 6.32e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014791   Gene: ENSMPUG00000014902   Transcript: ENSMPUT00000015026
Sequence length 959
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:31794415:31868358:1 gene:ENSMPUG00000014902 transcript:ENSMPUT00000015026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGDSSRKTSEMECFHTRFSAWTPFGNKSLNRQLFQERVALISHWFDLWTHKQRQEFLF
TIFLRCTKSQLRFVQDWFSERTQVAKVDFSTVLPRFISLYIFSFLNPKELCVAAQVSWPW
KFLTEQDCLWMPKCIRFGWFLPYTPTDNEYGAWKRHYIACVSSLDWLIPREASAVYGTLN
EPKTEDEELLERQREKCLRKIIWEKIALRKKELFKVRPPWVSGTCCSRLLKSKCQPRLSQ
ALRDRVGLHEALEKQLILASLQALPKRSNVSGSHSYPSLLKKTWRGVQKNDDSSSYASQP
HFLLISSRIPAFEMVVDSIKAGIIFVVYEHSGLTLESLLYLIEKALDGQKVQSMGIFSDG
DSREINLLQGYKIGIGNLLRPEVRDFWEKLGSCVAPEEEGGHVDLFVPLGASEAGLEVLS
QLSQLTGTFFTAPTGIATGSYQHILGDWLERPWERAPCSIYFRESKLQTWSSLTDFLEDT
LKSVRKQLSPLFKELQKNISARIIGQFTSDNMHVANILNNQEIAQTLADGLMELSKENSD
KPLEFLSSFLLKRRGKGRKDFEENVIPTECGPKAAFSLLLKERNVLEDKPQDTKSSLSNN
DPNLEMLIKLERKLRMDSAEKRSRVAGELLQSERKYVQMLEIVRDVYVLPLKAALSSNRA
ILSAANIHIIFSDILQILSLNRQFLDHLRDRLQEWSPAHCVGELFLKFGSQLNTYTNFFN
NYPVVLRTIEKSREMTPAFRAFLKRRDKTVVTKMLSLPELLLYPSRRFEEYMNLLYALRL
HTPAGHADRGSLTAAIDQLKTYKSYIDEMKHNIGMKDQLSEIQRIVWGCPTLLEESRYLI
RVQDVAQLHCCDEAVSFSLRSYEHTRDLSLFLFNDALLVSSRGTVHTPFERTSKSTYQFI
ASVALHRLLVEDIPDSKYIKNAFILHGPKCEWICATEVEDDKFLWLSVLQSAIKSSMEK
Download sequence
Identical sequences M3YTY1
ENSMPUP00000014791 XP_004740363.1.14098 ENSMPUP00000014791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]