SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014801 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000014801
Domain Number - Region: 289-460
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000931
Family BAR domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014801   Gene: ENSMPUG00000014912   Transcript: ENSMPUT00000015036
Sequence length 713
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:32137774:32209521:-1 gene:ENSMPUG00000014912 transcript:ENSMPUT00000015036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVNHSVQLSGEPQSTPPGDSSSLLSQNGLEKQDDKDSSTTLQTTEDKAGVQSEQGVQDI
SEELNRQLEDIINTYGSATEKEGPAKAKEPPENIEPLDNEDLDGDEATEETEREHLSSGE
PTTTKEPVSNKEQKLEKKILKGLGKEANVLMQNLNKLQTPEEKLDFLFKKYAELLDEHRT
EQKKLKLLQKKQVQIQKEKDQLQSEHSRAVLARSKLESLCRELQRHNKTLKEETLQRARE
EEEKRKEITSHFQTTLTDIQAQIEQQSERNMKLCQENTELAEKLKSIIDQYELREEHLDK
IFKHRELQQKLVDAKLEQAQEMMKEAEERHKREKEYLLNQAAEWKLQAKVLKEQETVLQA
QLTLYSGRFEEFQNTLTKSNEVFATFKQEMDKTTKKMKKLEKDTAMWKARFENCNKALLD
MIEEKALRAKEYECFVTKIGRLENLCRALQEERNELYKKIRDAKMPETDDRGQHTSDEEP
ESAVSGGVGVDTKEAESVHNAVKNLATAFMVIPHPESPPDLARESQPEFGSPQGGADSAL
REPEQSPRSPLCPSRPPPTPPAEAEGSHAAELPSRPGNPPAGLGAQAQNPGLPAAAQADQ
PPQKAEAEAPSQAPQSPSEAPLPAMEAKGWAPPARPAEPTPAGVPACGPRRPPPPPPPEA
AAEGLPPPPPEAAAEALPPPPPEAAAEALPPPPPEAAAEGLPEGADTNLEGVD
Download sequence
Identical sequences M3YTZ1
XP_004740372.1.14098 ENSMPUP00000014801 ENSMPUP00000014801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]