SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014808 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014808
Domain Number 1 Region: 415-610
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.9e-69
Family Nuclear receptor ligand-binding domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 128-217
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-29
Family Nuclear receptor 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014808   Gene: ENSMPUG00000014919   Transcript: ENSMPUT00000015043
Sequence length 613
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:853034:859824:1 gene:ENSMPUG00000014919 transcript:ENSMPUT00000015043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLAQGCSAYFPPSPTGSL
TQDPARSFGSVPPSLSDDGSPSSSSSSSSSSSFYNGNPPGGLQVALEDSSRVSPSKSTSN
ITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRIN
RNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSP
TQHPTPGPLGPSPPPAPAPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFT
YAHDKLGTSPGNFNANHASGSPPATTPHCWESQGCPPVPTDNNIMAAQRHNEALNGLRQA
SSSYPPAWPPGSAHHSCQQPNSNGHRLCPTHVYPAPEGEAPANSPRQGNSKNVLLACPMN
MYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLM
VRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFT
AVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNNM
HSEKLLSFRVDAQ
Download sequence
Identical sequences M3YTZ8
ENSMPUP00000014808 ENSMPUP00000014808 XP_004764676.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]