SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014813 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014813
Domain Number 1 Region: 335-381
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-17
Family TRASH domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014813   Gene: ENSMPUG00000014924   Transcript: ENSMPUT00000015048
Sequence length 1557
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:12687225:12805011:-1 gene:ENSMPUG00000014924 transcript:ENSMPUT00000015048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLSFSLQGLFHGCALQFKFEQKTGAVFDEIVENCGGIMDTEMSEDIDHNLTPTLDSMS
YGMPNQTGSENSLLDEDDYFLNSGDLAGIPVVGSDNEDEQDFSSKDNLVSSIHTDDSLEV
ERRVTQHESDNENEIQIQNKLKKDFPKQFDQVSVFKSIRKDFSLVRENSKETFSGKEKNR
DLTYHEREKRLDKPHKELDSRLKSSFFDKAANQVEETLHTHLPQTPETNFRDSSYPFASK
ESIGSELGNSFASNIRIKEEPLDDEYDKAMAPQQGLLDKIKDEPDNAQEYSHGQQQKTQE
GELKISAVFSVSGSPLAPQLTTGFQPSLASSGMNKMLPSVPATAVRVSCSGCKKILQKGQ
TAYQRKGSTQLFCSTLCLTGYTVPPARPPPPPTKKTCSSCSKDILNPKDVISAQFENSTT
SKDFCSQSCLSTYELKRKPVVTINTNSISTKCSMCQKNAVIRHEVNYQNVVHKLCSDACF
SKFRSANNLTMNCCENCGGYCYSGSGQCHMLQIEGQSKKFCSSACVTAYKQKSAKITPCA
LCKSLRSSAEMIENTNSLGKTELFCSVNCLSAYRVKMVTSAGVQVQCNSCKTSAIPQYHL
AMSDGSIRNFCSYSCVVAFQNLFNKPAGMNSSVVPLSQGQVIVSIPTGSTVSAGAGSTSA
VSPTSISSSAAAGLQRLAAQSQHVGFARSVVKLKCQHCNRLFATKPELLDYKGKMFQFCG
KNCSDEYKKINNVMAMCEYCKIEKIVKETVRFSGADKSFCSEGCKLLYKHDLAKRWGNHC
KMCSYCLQTSPKLVQNNLGGKVEEFCCEECMSKYTVLFYQMAKCDGCKRQGKLSESLKWR
GEMKHFCNLLCILMFCNQQSMCDPPSQNNAASISMVPAASAGPPSLRKDSTPVIANVVSL
ASAPAAQPTVNSNSVLQGAVPTVTAKIIGDASTQTDALKLPPSQPPRLLKNKALLCKPIT
QTKATSCKPHTQNKECQTEDTPSQPQIIVVPVPVPVFVPIPLHLYTQYAPVPFGIPVPMP
VPMLIPSSMDNEDKVTESIEDIKEKLPSHPFEADLLEMAEMIAEDEEKEKTLSQGGSQTS
EQELFLDTKIFEKDQGSTYSGDLESEAVSTPHSWEEELNHYALKSNAVQDADSDLKPLSK
GETEQDLEADFPSESFDPLNKGQGIQARSRTRRRHRDGFPQPRRRGRKKSIVAVEPRSLI
QGAFQGCSVSGMTLKYMYGVNAWKNWVQWKNAKEEQGDLKCGGIEHAASSPCSDSLGSSQ
DHALSQESSDPSCRVRSIKLKEDILSCTFAELSLGLCQFIQEVRRPNGEKYDPDSILYLC
LGIQQYLFENGRIDNIFTEPYSRFMIELTKLLKIWEPTILPNGYMFSRIEEEHLWECKQL
GAYSPIVLLNTLLFFNTKYFQLKNVTEHLKLSFAHVMRRTRTLKYSTKMTYLRFFPPLQK
QESEPDKLTVGKRKRNEDDEVPVGVEMAENTDNPLRCPVRLYEFYLSKCSESVKQRNDVF
YLQPERSCVPNSPMWYSTFPIDPGTLDTMLTRILMVREVHEELAKAKSEDSDVELSD
Download sequence
Identical sequences M3YU03
ENSMPUP00000014813 XP_004740882.1.14098 ENSMPUP00000014813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]