SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014823 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014823
Domain Number 1 Region: 20-147
Classification Level Classification E-value
Superfamily Lysozyme-like 1.34e-50
Family C-type lysozyme 0.000000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014823   Gene: ENSMPUG00000014934   Transcript: ENSMPUT00000015058
Sequence length 148
Comment pep:known scaffold:MusPutFur1.0:GL897186.1:1372125:1374742:-1 gene:ENSMPUG00000014934 transcript:ENSMPUT00000015058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSILIITLLSCFCAVYEAKIFSKCKLAHKLKTKGMDGYHGYSLADWVCMAQYESNFNTR
AFNGKNANGSSDYGLFQLNSKWWCKNSHHSSANACNIMCSKFLDDNINDDIVCAKRVVRD
PKGMSAWMAWVKHCKGKDLSKYLASCKL
Download sequence
Identical sequences M3YU13
XP_004778978.1.14098 ENSMPUP00000014823 ENSMPUP00000014823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]