SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014825 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014825
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily Lysozyme-like 4.69e-48
Family C-type lysozyme 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014825   Gene: ENSMPUG00000014936   Transcript: ENSMPUT00000015060
Sequence length 142
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897186.1:1411201:1412966:1 gene:ENSMPUG00000014936 transcript:ENSMPUT00000015060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSFISLLLVGIMFPAIQAKQFTKCELSQVLKDMDGFGGIALPEWICTIFHTSGYDTQTI
VNNNGSTEYGLFQINNKVWCKDNKILQSRNICNISCDKFLDDDLTDDMTCAKKILNKEGI
DYWLAHKPLCSEKLEQWHCEKL
Download sequence
Identical sequences M3YU15
XP_004778979.1.14098 ENSMPUP00000014825 ENSMPUP00000014825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]