SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014826 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014826
Domain Number 1 Region: 75-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.41e-16
Family TRASH domain 0.0032
Further Details:      
 
Domain Number 2 Region: 568-887,963-1042
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000281
Family Hermes transposase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014826   Gene: ENSMPUG00000014937   Transcript: ENSMPUT00000015061
Sequence length 1078
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:12951054:12980745:-1 gene:ENSMPUG00000014937 transcript:ENSMPUT00000015061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKESPIDGKCDKAGTPQLGQLDEIKTEPENAQEYCQAQQPKTQENELKINTTFSDSAPQL
TAGIQLSLTSSGMNKMLPSVSTTAIQVSCCGCKKILQKGQTAYQRKGSTQLFCSTLCITE
YISSANSPALPRRTCSNCSKDILNLKDVISVQLEDNTSSKNFCSQSCLSSYEEKRKAFVT
ICTNSVLTKCSMCQKTTVKPTKTLTSVPCKSLKPSDEMIETTSDLGKTDIFCSINCFSAY
NKTKMESSTVNVSMVHDASTDTFSPKKDTTPVISNIVSLADARVSLPIMNSDVLQADTVS
SVTANVIVDSLPSESSSGIATSSVEQPSLSPSSSIPGQPTVDSSVEVQKDKVSDQDASYN
MKSMKISEGLCHPKFTSRVQKIKDKSQNIKKSWCSNFQHLKNNIKKDVTFCYSCQLFCQK
NFNCGGESFTAQGISNWKKTLEKFRKHEKSEMHLKSLQYWREYQFFDDAVNDSLSIHSKQ
IEGNKKYLKLIIENILFLGKQCLPLRGNDQSISSVNKGNFLELLEIRAKDKGEEVFRLTN
LQVDFYNSTQIQNDIIEIIKTEMLQDIVNEINASSAFSIICDETTDSATKKQLSICVRYP
QKMSKAVLIKERFLGFIDIEEMTGTDLHGTIKTYLQQIGVDLNKICGQAYDSTTNLRGQF
NKIAAEFKKEEPRALYVHCYAHFLDLTVITFCKEVKELRSALNTLNSLFNTIHMTGEMSA
KFQNIFKLSQNKTCKKHTSKSCWTVHDHILLSVIEGLPEIIETLEVISSHSSNTSLADEL
SDLLILVSKFEFIFCLKFLYRVLSVTGILSKELQSETIDIFSLSSKIEAILECLSSERND
AYFKTIWDGAEEICQKITSKGFEVERPSFQKRRRIQKTVDLGNSDSMFFPTSTEEQYKIN
IYYQGLDTILNNLKLCFSEFDYCKMKQISELLFKWNEPLNETTAKHVQEFYKLDADIIPE
LRFYRQYAKLNFLIDYDHINFINLGCLFIQHGLHNNIPCISKLLYTALSWPVTSNAENSF
STLPRLKTYLCHTMGQEKLSGLALIAIEQELVNKLMEPERLNGIVEKFIHQMKETNTC
Download sequence
Identical sequences M3YU16
ENSMPUP00000014826 ENSMPUP00000014826 XP_012901562.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]