SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014830 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014830
Domain Number 1 Region: 79-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.28e-16
Family TRASH domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014830   Gene: ENSMPUG00000014941   Transcript: ENSMPUT00000015065
Sequence length 733
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:13003525:13046114:1 gene:ENSMPUG00000014941 transcript:ENSMPUT00000015065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEPLDGECGKAMAPQQGLLDKIKEEPDNAQEYGHAPKPKTQESELKISAVFSVGDSPLA
QQLTPGFQFSLASSGPNISLPLVPAVAIQVFCSGCKKMLHKGQTAYHKTGSTQLFCSTRC
ITGYSSSVCIPPPPKKTCTNCSKDILNPKDVITTRFENSSPSKDFCSQSCLSSYELKKKP
VVTIYTNSISTKCSICQKNADIRFEVKYQNVVHGLCSDACFSKFHSANNLTMNCCENCGS
YCYSSSGPCQSQKVFSSTSVTAYKQNSAQTPPYALGKSLRPSAEMIETTNDSGKTELFCS
INCLSAYRVKTVISSDQGVQVSCHSCKTSAIPQYHLAMSNGTIYSFCSSSCVVAFQNVFN
KPKGTNSSAVPPSQGQVVVSPPSGSAVSAAGGNASASSGSSPTGSISSSASGTAGFRPLA
APSQQVAVARTLVKLKCQHCSHLFATKPELLFYKGKMFLFCGKTCSDEYKKKNKVMAMCD
YCKLQKIIKETVRFSGVDKPFCSEVCKFLSARDFGERWGNYCKMCSYCSQTSPNLVENRL
EGKLEEFCCEDCMSKFTVLFYQNMFGSCEGRANMVKISSLIDYRLNHICHVPIFYVIIYS
LRLVGLVVEFSFYNMVNIYKAASASVELSSARKNTTPVITSVVSLAKIPPTQPTGNTNSV
LKGTITKEAAKIIEDGIMQTDALKLLSSQSSRLLKNKAVLCKPVTQTKATSCKPHTQHKE
CQTDFPMPNEKHD
Download sequence
Identical sequences M3YU20
ENSMPUP00000014830 ENSMPUP00000014830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]