SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014861 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014861
Domain Number 1 Region: 69-236
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.86e-47
Family Ankyrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 442-505
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000758
Family SAM (sterile alpha motif) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014861   Gene: ENSMPUG00000014971   Transcript: ENSMPUT00000015097
Sequence length 675
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:11837450:11870431:1 gene:ENSMPUG00000014971 transcript:ENSMPUT00000015097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRTWQRRLYSEPNGFRTCLPSPVMSRVAGNLRFLAVVPTLCLGPASLPALVNLPCEMA
GRGWHLLRLFRRELDLNKKNGGGWTPLMYASYIGHDTIVHLLLEAGVSVNVPTPEGQTPL
MLASSCGNESIAYFLLQQGAELEMKDIQGWTALFHCTSAGHQQMVKFLLDSGANANVREP
VYGFTPLMEAAAAGHEIIVQYFLNHGVRVDTRDHSGATARMLAKQYGHMKIVGLIDAHSP
ALPKNVYRSPDKFEDLSSSDESCPVPQRQRPCRKKGLSIHEGPRALARITAIGLGGKMQQ
PCREQVPLPGYVTFNSSDENPLVAGGLCYRDVTSPINDRDVESSSSSSREERALCASLGA
GGRSSSSEGLTRAPGVSSEASLESNEDSDHACQSSVRKQTKSYMKTKNRYSNSASPWPPG
TCPPGAASSPGSMTQTERCPHSGPQDLATLLDQIGCRKYLQVFEEQDVDLRIFLTLTESD
LKEIGITLFGPKRKMTSAIARWHSSARPPSDALELAYADRLEAEMQELAIQLHKRCEEVE
AMRGQVSQEQELRAVVESCLLEQDGARKDVHAQLQETWALARDAALVLEQLRACQAELSA
RVKQEVPTRGSPLGRALLPTADSSGWQASLQTLSLPELSGALEDRVQEMGRVLCSVTQSL
EKLQVLNGKENWREP
Download sequence
Identical sequences M3YU51
ENSMPUP00000014861 ENSMPUP00000014861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]