SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014876 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014876
Domain Number 1 Region: 936-1302
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.58e-77
Family Ankyrin repeat 0.000011
Further Details:      
 
Domain Number 2 Region: 1320-1445
Classification Level Classification E-value
Superfamily TPR-like 6.42e-22
Family Tetratricopeptide repeat (TPR) 0.0015
Further Details:      
 
Domain Number 3 Region: 393-475,574-675
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000119
Family G proteins 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014876   Gene: ENSMPUG00000014986   Transcript: ENSMPUT00000015112
Sequence length 2060
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:15035391:15393478:-1 gene:ENSMPUG00000014986 transcript:ENSMPUT00000015112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRNSLKMLLTGGKSSRKNRSSDGGSEEPPDRRQSSVDSRQSRSGQGGISTESDCAFEPD
YAVPPLPVSEGMQHIRIMEGMSRSLPSSPLLTHQSISVRLQPVKKLTAPLRKAKFVESPR
IPESELDSPTLASAQKLDVDTYCPGDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQ
PGDQYNMEVQDENQTSAITQRISPCSTLTSSTASPPASSPCSTLPPVSTNAAAKDCSYGA
VTSPTSTLESRDSGIIATLTSYSENVERTKYVGESSKELGSGGNLKPWQSQKSSMDSCLY
RVDENMTASTYSLNKIPERNLETVLSQSVQSIPLYLMPRPNSVAATSSAHLEDLAYLDEQ
RHTPLRTSLRMPRQSMGGARTQQDLRVHFAPYRPPDISLKPLLFEVPSITTESVFVGRDW
VFHEIDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHGTRMRQIASDSPHASPK
HVDANRELPLTQPPSAHSSIPSGSCPGTPEMRRRQEEAMRRLASQVVAYHYCQADNAYTC
LVPEFVHNVAALLCRSPQLTAYREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENL
HKERKIPDEDFIILIDGLNEAEFHKPDYGDTIVSFLSKMIGKFPSWLKLIVTVRTSLQEI
TKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHL
KTLSQGSYLYLKLTFDLIEKGYLVLKSSSYKVVPVSLSEVYLLQCNMKFPTQSSFDRVMP
LLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSMFLIKRRDMTRMFVHPS
FREWLIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLS
KKVGVSSSILQGLWISYSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNA
PILCVQSHLGYTEMVALLLEFGANVDASSESGLTPLGYAAAAGYLSIVVLLCKKRAKVDH
LDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGYTEI
VSYLLDLPEKDEEEVERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRR
GAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASEGHLGTVDFLLAQGASI
ALMDKEGLTALSWACLKGHLPVVRSLVDNGAATDHADKNGRTPLDLAAFYGDAEVVQFLV
DHGAMIEHVDYSGMRPLDRAVGCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSK
LMEEGDMFYKKGKVKEAAQRYQYALKKFPREGFGEDLKTFRELKVSLLLNLSRCRRKMND
FGMAEEFATKALELKPKSYEAYYARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLL
RVEEECRQGQPPPQQPPQPPLPEETEPEPQHEDLYSVQDIFEEEYLEQDVENVSIGLQTE
ARPSQGLPIIQSPPASPAHRDSAYISSSPLSSHQVFDFRSSSSVGSPTRQGYQSTSPALS
PTHQNSHYRPSPPHTSPAHQSGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQYRASPPAES
MSVYRSQSGSPVRYQQDTSVSQLPGRPKSPLSKMTQRPYQMPQLPVAVPQQGLRLQPAKA
QIVRSNQPSAAVHSSSVVSTGAYGQVAHSMASKYQSSQGDMGVSQSRLVYQGSIGGIVGD
GRPVQHVQASLSAGAICQHGGLTKEDLPQRPSSAYRGGMRYSQTPQIGRSQSASYYPVCH
SKLDLERSSSQLGSPDVSHLIRRPVSVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSIS
SASNLTPTFRPSSSIQQMEIPLKPAYDRSCDELSPVSPTQGGYPSEPTRSRTTPFMGIID
KTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFYNKTNNAQ
NGHLLEDDYYSPHGMLANGSRGDLLERVGQASSYPDVKVARTLPVAQAYQDNLYRQLSRD
SRQGQTSPIKPKRPFVESNV
Download sequence
Identical sequences M3YU66
XP_004749279.1.14098 ENSMPUP00000014876 ENSMPUP00000014876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]