SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014904 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014904
Domain Number 1 Region: 344-449
Classification Level Classification E-value
Superfamily Homeodomain-like 5.02e-35
Family SWIRM domain 0.0000824
Further Details:      
 
Domain Number 2 Region: 66-119,159-204
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000449
Family BRCT domain 0.07
Further Details:      
 
Domain Number 3 Region: 518-571
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000179
Family Homeodomain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014904   Gene: ENSMPUG00000015015   Transcript: ENSMPUT00000015141
Sequence length 1006
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:2612406:2756729:1 gene:ENSMPUG00000015015 transcript:ENSMPUT00000015141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSMAKCFMDFKAGGTLCHILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQ
NNCLTRPNIYLIPDIDLKLANKLKDIIKRHQGTFTDEKSKASHHIYPYPSSQEDEEWLRP
VMRKDKQVLVHWGFYPDSYDTWVHSNDVDAEIEDPPIPEKPWKVHAKWILDTDVFNEWMN
EEDYEVDENRKPVSCRQRISTKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPAESRK
KSGKKGQASLYGKRRSQKEEDEQEDLTKDMEDPTPVPNIEEVVLPKNVNPKKDSENTPVK
GGTVADLDEQDEETVTAGGKEDEDPSKGDQSRSLDPGEDNVTEQTNHIIIPSYASWFDYN
CIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCA
VMRVHAFLEQWGLVNYQVDPESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQ
MLNFPEKNKEKPIDLQNFGLRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDD
WNKVSEHVGSRTQDECILHFLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAF
LASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSC
IAGTGPDEPEKLEGAEEDKMETDTDGQQPEKAENKGENETDEGDKAQDGENEKNSEKEQD
SEVSEDTKSEEKETEENKELTDTCKERESDLGKKKVEHEISEGNVATAAAAALASAATKA
KHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQN
FHMEQLKYAELRARQQMEQQQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPL
MHHQMPPPHPPQPGQIPGPGSMIPGQPMPGRMIPTVAANIHPPGSGPAPPGMPPMPGNIL
GPRVPLTAPNGMYAPPPPQPPPPPPPPPADGVPPPPAPGPPASAAP
Download sequence
Identical sequences M3YU94
ENSMPUP00000014904 ENSMPUP00000014904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]