SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014927 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014927
Domain Number 1 Region: 250-354
Classification Level Classification E-value
Superfamily SH3-domain 7.37e-24
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 2 Region: 61-126
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000464
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014927   Gene: ENSMPUG00000015038   Transcript: ENSMPUT00000015164
Sequence length 377
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:1539536:1552195:1 gene:ENSMPUG00000015038 transcript:ENSMPUT00000015164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEMSEKENEPDDAATHTPPGTISALQETKLQRFKRSLSLKTILRTSTDGDVPTPAPSPC
PIPRPLAPLKPVRLHSFQEHVFKRASPCELCHQLIVGNSKQGLRCKTCKVSVHLWCSEEI
SRQQCPGKASSSFRRNFSSPLLVHEPPPACVTSRESPPTGASGKVDPVYETLRYGTSLAL
MNRSSFSSTSESPTRSLSERDELNEDGEGSIRSSEEAPGESVFTAPAESEGSGPEEKSPG
QQVGASMPPKPLLRKDVGPMYSYVALYKFLPQENNDLALQPGDRIMLVDDSNEDWWKGKI
GDRVGFFPANFVQRVRPGENVWRCCQPFSGNKEQGYMSLKENQICVGVGRSKDADGFIRV
SSGKKRGLVPADALTEI
Download sequence
Identical sequences M3YUB7
ENSMPUP00000014927 ENSMPUP00000014927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]