SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014934 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014934
Domain Number 1 Region: 1466-1687
Classification Level Classification E-value
Superfamily SET domain 9.42e-57
Family Histone lysine methyltransferases 0.00072
Further Details:      
 
Domain Number 2 Region: 2388-2422
Classification Level Classification E-value
Superfamily WW domain 0.0000000025
Family WW domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014934
Domain Number - Region: 1283-1340
Classification Level Classification E-value
Superfamily Ferritin-like 0.0673
Family Ribonucleotide reductase-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014934   Gene: ENSMPUG00000015045   Transcript: ENSMPUT00000015171
Sequence length 2564
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:3137248:3231934:1 gene:ENSMPUG00000015045 transcript:ENSMPUT00000015171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKSIWPHEKPAFGPSYCPLLQDGNREEENEAKIENVQKTGFIKGPMFKGVASSRFLPKGT
KTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQNDTPNSPAGPLQVDLTPKIKMD
IADTLSTTEDSSPPKSRVELGKIHFKKHLLHVTSRPLLTPATAVSSPPPPIAPLPAVIAE
STTVDSPPSSPPPPPPPPQATTPSPPAPVTEPVALPHTPIPVLMTAPVDVAVRALKEPPV
TTVPESSEVDTKQEAAVSNSSEEHITQNLNEQVDIASQKEDSHIGKEEEIPDSSKSNLGS
KKTGSKKKSSQSEGTFLASESDEDSVRTSSSQRSHDLKFSASIEKERDSKKSLAPLKNED
LGKSSRSKTERDDKYFSYSKLERDTRYISSRCRSERERRRSRSRSRSDRGSRTSLSYSRS
ERSHYYDSDRRYHRSSPYRERARYSRPYTDNRARESSDSEEEYKKTYSRRTSSHSFSYRD
LRTSSSYSKSDRDCKTESSYLEMEKRGKYSSKLERESKRTSENEAMKRCCSPPNELVFRR
GSSYSKHDNSASRYKSTLSKSISKSDKFKNSFCCTELNEEIKPSHSSNLQAPCSKGSDLR
MISKIPEREKTGSPSPSNRLNDSPTFKKLDESLIFKSEFIGHDSHDSIKELDSLSKVKND
QLRSYCPIELNINGSPGAESDLATFCTSKADTVLMSSDDSVTGSEVSPLVKGCMLPSNGF
QNVNRCKEKDSDDSCMLHSKSGSPFREAEPPVSPHQDKLLSLPVMTIDYSKTVIKEPVDM
TVSCCKTKDSDICCTSNDKNPSLHHSEAEKIEPSVMKISSNSFMNVHLKSKTVICDNRNL
TDQHSKFACEEYKQNVGSTSSASVNHFDDLYQPIESSGIASSLPSLPPGIKVDSLTLLQC
GENTSPVLDAVLKSKSTEFLKHAEKETVAEVGSGLPDSGRGFASWENRHNNGLSGKCVQE
AQEEGNSVLPDRRGRAEISLDEEGGRGHVHTSDDSEVVFSSCDLNLTMEDSDGVTYTLKC
DSSGHASEIVSTVHEDYSGSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPME
ETSPCSSRSSQSYRHYSDHWEDERLESRRHSYEEKFESVASKPCSQTEKFFHHKGTEKNL
EVSFSQPSRKQIDNHLSEIAHPQSDGVDSTSHTDVKSDFLGHPNSEETTKAKIASRQQEE
LPVYSSDDFEDVPSKSRQQITFPNRPDSRLGKTELSFSSSCERVDGFRSSEELRNVGWEF
SQQEKPTTTYQQPDSSYGACGGHKYQQSAEHYGGTRNYWQGNGYWDPRSAGRPPGTGVVY
DRIQGQVPDSLTDDREEEENWDQRGGSHFSTQSSKFFLSFQKDKGSVQAPEISSNSVKDS
LTVNEKKDLSKNLEKNDMKDRGPPKKRRQELESDSESEGELQDRKKVRVAVEPGETAVPP
ASALVGPSCVMEDFRDPQRWKEYAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCE
CTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKK
GWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQK
GNCSRFMNHSCEPNCETQKFYIKGTCEFYFFNHSVVPFHIKIAFDYCCHKYRKEAQKCFC
GSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVLSLSR
LMVRIETLEQKLTCLELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEI
IKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAIPQLSEGDGYSSENTSRAHTPLNTPDP
SAKLSTEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEEE
EELQSQQLLTQQLPESKVESEITVEASKLPTSEPEADTEIEPKEGNGPKLEETIAEETPS
QDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTITER
GRDAVGFRDQTAAPKTPNRSRERDPDKQTQNKEKRKRRGSLSPPSSAYERGTKRPDDRYD
TPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQTLGMTSPLPYDSLAYNAP
HHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPNMDPVCSPAPYDHSQPLVGHSTEPLAAP
PPVPVVPHVAAPVEVSSSQYVAQSEGVVHQDSSVTVLPVPAPGPVQGQNYGVWDSNQQSV
SVQQQYSPAQSQATIYYQGQTCPTVYGVTSPYSQTTPPIVQNYAQPSLQYIQGQQIFTAH
PQGVVVQPAAAVTTIVAPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARD
PEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEA
DTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKE
LKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
Download sequence
Identical sequences M3YUC4
ENSMPUP00000014934 ENSMPUP00000014934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]