SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014937 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014937
Domain Number 1 Region: 304-434
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-33
Family Ran-binding domain 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014937   Gene: ENSMPUG00000015048   Transcript: ENSMPUT00000015174
Sequence length 490
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:41666987:41713013:1 gene:ENSMPUG00000015048 transcript:ENSMPUT00000015174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTVQRKGSSHLFNSSYICKLKLPQDQRPQEKSVIAQPVFVFAKRENTFKRPAEDTFEAA
EHESNDFLRKRARSSSFTLHTTDPQFQGASTLSQNRMRSSSFTNLLTFPPSGPVKKNNVF
MTSTLVQRNVDMNSTEQGPVKHSDHVLRPAVLQPPQAQRCEKLRKTFVHNTLESCKTKEK
TKNKISEGNSSLLSENLPSARISVQLTTSQNCLGATSVGCQAKEDKYSFKSCSSDFVFGE
NMVERVLDTQHLTHSQLENDSYTKEKPFKSTLEFPVNSPNSSTDSLKNISLIESAAAFSS
TPSPKCLLEKIDVVTGEEAEHNVLKINCKLFIFNKTTQSWTERGRGALRLNDTASSDCGT
FQSRLIMRNQGSLRLILNSKLWAQMEIQRANHKNLRITATDLEDYSIKVFLIQASAKDTG
CLYAAIHHRLLALRSFNKQKDVNQAESQSEAILQQLNCESCDEDEDDFLQVTKNRSDPSR
WTHRQSVACS
Download sequence
Identical sequences M3YUC7
ENSMPUP00000014937 XP_004738062.1.14098 ENSMPUP00000014937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]