SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014942 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014942
Domain Number 1 Region: 227-412
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-49
Family Nucleotide and nucleoside kinases 0.000000026
Further Details:      
 
Domain Number 2 Region: 81-226
Classification Level Classification E-value
Superfamily SH3-domain 9.35e-40
Family SH3-domain 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014942   Gene: ENSMPUG00000015053   Transcript: ENSMPUT00000015179
Sequence length 583
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:1563943:1588943:1 gene:ENSMPUG00000015053 transcript:ENSMPUT00000015179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKTSMSRSPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR
LSSSKSGDNSSSSLGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIVLVGPSLK
GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA
EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRG
KSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP
NPLLNRTMATAALAASPAPVSNLQGPYLPSGDQSLERATGEHASVHEYPGELGQPPGLYP
SSHPPGRAGTLRALSRQDTFDADTPGNRNSAYTELGDSCVDMETDPSEGPGLGDPAGGST
PPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEAGDAPWDN
Download sequence
Identical sequences M3YUD2
ENSMPUP00000014942 ENSMPUP00000014942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]