SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014959 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014959
Domain Number 1 Region: 20-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.8e-47
Family C-type lysozyme 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014959   Gene: ENSMPUG00000015070   Transcript: ENSMPUT00000015196
Sequence length 148
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897201.1:136370:150562:-1 gene:ENSMPUG00000015070 transcript:ENSMPUT00000015196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAGILALIGCLVMATEPKVYTRCKLAKIFSRAGLDNYQGFSLGNWICMAYYESHYNTT
AQTELEDGSIDYGIFQINSFTWCRRAKLQEKNHCHVACSALITDDLTDAIICAKKIAKET
EGMNYWQGWKRHCEGKDLSEWKKGCEVS
Download sequence
Identical sequences M3YUE9
ENSMPUP00000014959 ENSMPUP00000014959 XP_004779406.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]