SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014961 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014961
Domain Number 1 Region: 89-123
Classification Level Classification E-value
Superfamily WW domain 0.0000000000994
Family WW domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014961   Gene: ENSMPUG00000015072   Transcript: ENSMPUT00000015198
Sequence length 601
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897201.1:679646:765878:-1 gene:ENSMPUG00000015072 transcript:ENSMPUT00000015198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDAADPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHIHRVRERDGGTSYSPQENSHNHS
ALHSSNSHSSNPSNNPSKTSDTPYDSADDWSEHISSSGKKYYYNCRTEVSQWEKPKEWLE
REQRQKEANKMAVNSFPKDRDYRREVMQATATSGFASGMEDKHSSDASSLLPQNILSQTS
RHNDRDYRLPRAETHSSSTPVQHPIKPVVHPTATPSTLPSSPFTLQSDHQPKKSFDANGA
STLSKLPTPTSSVPAQKTERKESTPGDKSVSHSCTTPSTSSASGLNPTSAPPTSASAIPV
SPVPQSPIPPLLQDPNLLRQLLPALQATLQLNNSNVDISKINEVLTAAVTQASLQSIIHK
FLTAGPSAFNITSLISQAAQLSTQAQPSNQSPMSLTSDASSPRSYVSPRISTPQTNTVPI
KPLISTPPVSSQPKVSTPVVKQGPVSQSATQQPVTADKQQGHEPVSPRSLQRSNSQRSPS
PGPNHTSSSNASNATVVPQNSSARPTCSLTPTLAAHFNENLIKHVQGWPADHAEKQASRL
REEAHNMGSVHMSEICTELKNLRSLVRVCEIQATLREQRILFLRQQIKELEKLKNQNSFM
V
Download sequence
Identical sequences M3WRG4 M3YUF1
ENSMPUP00000014961 ENSFCAP00000016947 XP_004779410.2.14098 XP_011281956.1.62641 XP_012904805.1.14098 XP_012904807.1.14098 XP_012904808.1.14098 XP_015397810.1.5354 XP_019320793.1.44245 ENSMPUP00000014961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]