SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014962 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014962
Domain Number 1 Region: 2011-2313
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-123
Family BEACH domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 2372-2681
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.65e-30
Family WD40-repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 1911-2011
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-23
Family PreBEACH PH-like domain 0.0064
Further Details:      
 
Domain Number 4 Region: 581-731
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000656
Family Laminin G-like module 0.057
Further Details:      
 
Domain Number 5 Region: 318-342,375-503
Classification Level Classification E-value
Superfamily ARM repeat 0.00000121
Family HspBP1 domain 0.08
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014962
Domain Number - Region: 948-1289
Classification Level Classification E-value
Superfamily ARM repeat 0.00013
Family Pumilio repeat 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014962   Gene: ENSMPUG00000015073   Transcript: ENSMPUT00000015199
Sequence length 2722
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:3238366:3267187:-1 gene:ENSMPUG00000015073 transcript:ENSMPUT00000015199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASERLYELWLLYYAQKDLGYLQQWLKAFVGAFENSISLSSLEPRRPEEAGAEVPLLPL
DALHVLAEQLDAGDLEQALLLLRLFIVLCRNLENVEAGWGQVLLPRVLALLTRLMAELKG
TPASQEGRGLLLENVALHALLLCEGLFDPYQTWRRQHSGEVISSKEKSKYKFPPAALPCE
FSAFFRESLQGADGLPPMLLLRLVHLFGAILAGGKENGQMAVSAGSVQGLLGVVRGWDHG
PAQDPRLVPLALEALVGAVHVLHASRTPPRGPELRTLLEGYFRILNADWPAGPNPGPEEA
LVALRVSMLDAIPRMLACEDRPVLQATFLSNNCFEHLTRLIQNSKLYLQARAPPEGDSDL
ATRLLTEPDVQKVLDQDTDAIVVHVVRVLTSIMSGSSSAKEVFKERIGYPHLLEVLQSHG
PPTRRLLQELLNMAVEGDHSGCPPPPIVNEQPVLLLMQWLPALPTAELRLFLAQHLRWLC
DSCPASRGTCVQAGLVGHLLETLAAGVALGAHCQEQLLALLQALGRVSLRPLELRRLLRP
PPALDSEPSGTEAGKARHAGAIIRALSGMARRQGPARALHYFDLTPSMAGIMVPPVQRWP
GPGFTFHAWICLYPAAAAPAPAPSRPLQRKQLYSFFTSSGSGFEAFFTAAGTLVVAVCTR
KEYLTMSLPEVSFADSAWHCVAIVHVPGRRPFSQNLVHVYKDGQLVQTAALRCPSLSEPF
SSCCIGSAGHRTTTTTTGLPTPPVPTALAPPHPSLSRSQSVPATAGLGWGSGLVTPLQEG
SISSTLAGTQDTRWGSPTSLEGELGAVAIFHEALPAPALRALFTLGPKEMAPFKPEGELH
ELSTKLLLHYSPQACRNNICLDLSPGHGLDGRLTGHRVETWDVKDVVTCVGGMAALLPLL
ERVASQPQEAEAGPAETHDLVGPELTSAHNTQGLLLPLGKSSEVRMERNAVAAFLLMLRN
FLQGHVGNQESLVQCQGPAIIGALLRKVPSWAMDMNVLMSAQLLMEQVAAEGGGPLLYLL
YQHVLFHFHLWSPSDFAVRLGHIQYMSSIVREHRQKLRKKYGVQFILDALRTHYSPPREL
PLVADDVRTVQTSLLGLVREFLVRSSAAEDMQVVLSFLVASNDDGQVVGALDLFLALLQG
SPAQESLAVFLVEPGNLEVLLALLVRPRSRPLVPDRVCKILRKLQQNERLPERSRQRLRL
REYGLQGLVACLPEGAASPQLCQGLYRLFLGADCLNLSDLLAVVQLSLQADLSVRLDICR
QLFHLIYGQPDIVRLLARQAGWQDVLTRLYVLEAATAGSPLPFSPEPPTSPDPALCQPPT
ESPETSDVFLPSETPSPDPDAFYHALSPFCTPLDLGLERASVGSCNTGGGSSGTLTPASQ
PGTPSPLDGPRPFPGAHGRHSSSLSNVLEDGSLPEPTISGDDTSNTSNPQQTSEEELCNL
LTNVLFSVTWRGVEGSDEAAWRERGQVFSVLTQLGASATLVRPPDCIKRSLLEMMLESAL
TDIKEAPVGVLASLTQQALWLLRLLQDFLCAEGHGNQELWSEKLFEGVCSLLDRLGAWPH
LANGMADLREMAQIGLRLVLGYILLEDPQLHAQAYVKLHWLLQTAAVPMRREEACYVLSK
LEAALARALNTFPSKTTTEDTEPPGAAAAATERCSWLVPLVRTLLDRAYGLLGLQWGLPS
LPPTNGSPTFFEDFQVFCATPEWRHFIDKQVQPTMSQFEMDTYAKSHDLMSGFWNACYDM
LMSSGQRRQRERAHSRRAFQDLVLEPAQRRGRLEGLRYAAALKQQSTQHSTALLHWGALW
RQLSSPCGAWALRDPPVPRWKLSSAETYSRMRLKLVPNHHFNPHLEASALRDNLGEAPLT
PTEEASLPLAVTKEAKVSALPEELQEDQLGEDELAALEKAMQAAELDEQHEKLVLSAECQ
LVTVVAVIPGLLEITTQHVYFYDGSAERVETEEGIGHDFRRPLAQLREVHLRRFNLRRSA
LELFFIDQANYFLNFPCKVRNQVYSLLLRLRPPSQGYLSSRSPQEMLRASGLIQKWVQRE
ISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLQDYVSPTLDLSNPAVFRDLSKPIGVVNPK
HAQLVREKYESFEDPAGTIDKFHYGTHYSNAAGVMHYLIRVEPFTSLHVQLQSGRFDCSD
RQFHSVAAAWQARLESPADVKELIPEFFYFPDFLENQNGFDLGCLQLTNEKVGDVVLPPW
ASSPEDFIQQHRQALESEYVSAHLHEWIDLIFGYKQRGPAAEEALNVFYYCTYEGAVDLD
HVVDERERKALEGIISNFGQTPCQLLKEPHPARLSAEEAAQRLARLDTNSPSIFQHLDQL
KAFFAEVISDGVPLVLALVPHRQSHSFTIQGSSDLLVTVSASGLLGIHSWLPYDRNINNY
FSFSKDATIGNSKMQRLLSGPWVPDRGVDGQALAVAPDGKLLFSGGHWDGSLRVTALPKG
KLLKQLHCHLDVVTCLALDTCGIYLISGSRDTTCMVWRLLQEGGFSVGLASKPVQVLYGH
EAAVSCVAISTELDMAVSGSEDGIVIIHTVRRGQFVAALRPPGAMLPGPVSHLVLGSEGQ
IVVQSSAWERVGAQVTYSLHLYSVNGKLRASLPLVEQPTALAVTEDFVLLGTAQCALHIL
HLNKLLPAAPPLLMKVPIRSVAVTKECSHVLVGLEDGKLIVVGAGQPSEARSSQFARKLW
RSSRRISQVSSGETEYNPGEAR
Download sequence
Identical sequences M3YUF2
ENSMPUP00000014962 ENSMPUP00000014962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]