SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014984 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014984
Domain Number 1 Region: 786-914
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.76e-31
Family Synaptotagmin-like (S variant) 0.00000108
Further Details:      
 
Domain Number 2 Region: 1309-1429
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-23
Family Synaptotagmin-like (S variant) 0.0077
Further Details:      
 
Domain Number 3 Region: 598-722
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-21
Family PDZ domain 0.00000271
Further Details:      
 
Domain Number 4 Region: 30-72,125-204
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.24e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014984   Gene: ENSMPUG00000015095   Transcript: ENSMPUT00000015221
Sequence length 1458
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897038.1:664674:1263499:-1 gene:ENSMPUG00000015095 transcript:ENSMPUT00000015221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPVGPRGRPAPTPAASQPPLQPEMPDLSHLTEEERKIILAVMDRQKKEEEKEQSVLKV
KEEHKPQPTQWFPFSGITELVNNVLQPQQKQQNEKEPQTKLHQQFEMYKEQVKKMGEESQ
QQQEQKGDAPTCGICHKTKFADGCGHNCSYCQTKFCARCGGRVSLRSNKEDKVVMWVCNL
CRKQQEILTKSGAWFYNSGSNTSQQPDQKVLRGLRNEEAPQEKKAKVHEQAQFQGPSGDL
SVPAVEKSRSHGLTRQDSIKNGSGVKHQITSDIASDRTRSPSISRDQNRRYDQREEREEY
SQYATSDNAMPRSPSDYADRRSQREPQFYEESDHINYRDSSRRSHRHSKEYIVDDEDVES
RDEYERQRREEEYQARYRSDPNLARYPVKPQPYEEQMRIHAEVSRARHERRHSDVSLANA
ELEDSRISMLRMERPSRQRSISERRAAMENQRSYSMERTREAQGPSAYPQRTTNHSPPTP
RRSPIPIDRPDLRRTDLLRKQHHLDPSSAVRKTKREKMETMLRNDSLSSDQSESVRPPPP
KPHKSKKGGKMRQVSLSSSEEELASTPEYTSCDDVEIESESVSEKGDMDYNWLDHTSWHS
SEASPMSLHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRL
CAFITKVKKGSLADTVGHLRPGDEVLEWNGRFLQGATFEEVYNIILESKPEPQVELVVSR
PIGDIPRIPDSTHAQLESSSSSFESQKMDRPSISVTSPMSPGMLRDVPQYLSGQLSSQSL
SRRTTPFVPRVQIKLWFDKVGHQLIVTILGAKDLPSREDGRPRNPYVKIYFLPDRSDKNK
RRTKTVKKTLEPKWNQTFIYSPVHRREFRERMLEVTLWDQARVREEESEFLGEILIELET
ALLDDEPHWYKLQTHDVSSLPLPHPSPYMPRRQLHGESPTRRLQNKALCSYNSGSKRISD
SEVSDYDCDDGIGIVSDYRHNGRDLQSSTLSVPEQVMSSNHCSPSGSPHRVDVIGRTRSW
SPSVPPPQSRNVEQGLRGTRSAAGHYNTISRMDRHRVMDDHYSPERDSHFLTLPRSRYSQ
NIEHHHRDGRDCEAADRQPYHRSRSTEQRPLLERTTTRSRSTERPDTNLMRSMPSLMTGR
SAPPSPALSRSHPRTGSVQTSPSSTPVAGRRGRQLPQLPPKGTLERNNGVKEIEPYEEVN
EETGHVEEQWGEKQGEEVKAEAGGKKLRSTVQRSTETGLAVEMRNWMTRQASRESTDGSM
NSYSSEGNLIFPGVRLASDSQFSDFLDGLGPAQLVGRQTLATPAMGDIQVGMMDKKGQLE
VEIIRARGLVVKPGSKTLPAPYVKVYLLDNGVCIAKKKTKVARKTLEPLYQQLLSFEESP
QGKVLQIIVWGDYGRMDHKSFMGVAQILLDELELSNMVIGWFKLFPPSSLVDPTLAPLTR
RASQSSLESSTGPSYSRS
Download sequence
Identical sequences M3YUH4
ENSMPUP00000014984 ENSMPUP00000014984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]